KEGG   Maylandia zebra (zebra mbuna): 101466680Help
Entry
101466680         CDS       T02814                                 

Gene name
uchl5
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase L5
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101466680 (uchl5)
Peptidases [BR:mze01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101466680 (uchl5)
Ubiquitin system [BR:mze04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    101466680 (uchl5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 329 aa AA seqDB search
MSGSAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSMEPENFENLKPVHGLIFLFKWQP
GEEPAGSIVQDSRLDHIFFAKQVINNACATQAIISVLLNCSHPDMLLGDTLTEFREFSQS
FDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKDEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYERKIAELQA
QLTEDEPMDTDQSSTFLSSIQSEIAKYQLLIEEENQKLKRYKIENIRRKHNYLPFIMELL
KTLAEYQQLIPLVEKAKEKQSAKKAQEAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaagtgcaggagagtggtgtctcatggagagcgaccccggggttttcacggag
ctcataaaaggtttcggctgcagaggagcccaggttgaagagatatggagtatggagcca
gagaactttgaaaacttgaaacccgttcacgggttgattttcctgtttaagtggcagcct
ggtgaagagccagcaggatcaattgtccaggattcaagacttgatcacatcttctttgcc
aagcaggtcattaacaacgcttgtgccacccaggccatcatcagtgttttgctcaactgc
tctcatcctgacatgttgctcggcgatacgctgacggagttcagagagttttcacagagt
tttgatgcagctatgaaaggtttggctctcagcaactcagaagtgatccgacaagttcac
aacagctttgccagacagcaaatgtttgaatttgatgcaaagtcttcggcgaaggacgag
gacgcattccactttgtgagctacgttcctgtaaatggcaggctatatgagctggacggg
cttcgagaggggccgatcgacctgggtgcatgcaaccaggatgactggatcagcgcagtc
cgccctgtgattgaaaaaagaatacagaagtacagtgagggagagatccggttcaaccta
atggccatcgtgtctgacagaaaaatgatatatgagaggaaaattgcggagctccaggcc
cagcttactgaggatgaaccaatggacacagaccagagcagcacgttcctcagctccatc
cagtcagagattgccaagtaccagctccttattgaagaagaaaatcagaaactaaaaaga
tataagattgaaaatattcgacgaaagcacaactaccttcctttcatcatggagctgttg
aagacgctggcagagtaccagcagttaatacctttggtggagaaggcgaaagagaaacag
agtgccaaaaaagcccaggaggccaagtga

DBGET integrated database retrieval system