KEGG   Maylandia zebra (zebra mbuna): 101466910Help
Entry
101466910         CDS       T02814                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:mze00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mze00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 495 aa AA seqDB search
MAYKIPAAAMDRVSLLWRLRRRARRGVLCMTFFCISMALLYAICAENSVPVTDAIFGVRA
RTRAQPHAHNVIKVLRGGAKPMYTDPQKLPGVIPGDPRRPIPILSSSNHSHEARDSSSKR
KQREPPGFFSRLLPRPFTRALETLFGGRRKGELSGRGSDAEFFGPNGLLGEVWDDEMSSS
MLGTRMKKVVQNYQAMNKYGVELSGPGGVSGTPKLSGPELLCQLKDKVEVATLTPDLQPF
SLLPWATQLPPQQLTSDLGPYKSCAVVSSAGSLRYSGLGKEIDSHEAVLRFNAAPTTGYE
KDVGSKTTIRLINSQVMASDDHRFLSSSLYSSGVLVAWDPAPFSADLTKWFNRTDYPIFA
QYQRYRRLHPLQPFYILHPRFEWQIWQRIQDNMAEPIQKNPPSSGMLGTVLMMSLCEVVH
VYEFLPSRRKTELCHYYQRFYDAACTLGAYHPLLYEKNLVKRMNQGSDRDIYTSGRVTLP
GFRKLNCSQTAGGDR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaagatacccgcggcagcgatggacagagtcagcctgctgtggcgtctgagg
cggcgggctcgccgcggcgtgctctgcatgaccttcttctgcatctccatggctctgctc
tacgccatctgtgctgaaaacagcgtgcccgtcaccgacgccatctttggcgtccgggca
cgaacccgcgcgcagcctcatgcgcacaatgtcatcaaggtgctgcgaggtggagccaag
cccatgtacacggaccctcagaagctcccgggcgtcatcccaggcgaccctcgccgtccg
atccccatcctgtcctcgtccaaccacagccacgaagccagggattcgtcgtcgaagcgg
aaacagcgggagcccccggggtttttcagccggctgctgccgcgccccttcacgcgagcg
ctggagaccctgttcgggggccggcggaagggcgagctgagcggcagaggcagcgacgcc
gagttcttcgggcctaacgggcttttgggagaggtgtgggacgacgagatgtccagcagc
atgctggggaccaggatgaagaaggtggtgcagaactaccaggcgatgaacaaatacgga
gtcgagctgtcgggccccggcggcgtctctggcacgccgaagctgagcggtcccgagctt
ctctgccaactgaaggacaaagtagaggtcgcgactttgacccctgacctccagcccttc
tccttgctgccctgggccacccagctgcctccgcagcagctgacctctgacctcggaccc
tacaagagctgtgctgtggtgtcatcggcgggttcactgcgctactctgggctgggcaaa
gagatcgactcacatgaagctgtgctgcgcttcaacgctgcgcccaccaccgggtacgag
aaggacgtcgggtccaaaaccaccatccgcctcatcaactcacaggtgatggcgtctgat
gaccaccgcttcctgtccagttctctgtacagctcaggtgttctggtggcctgggacccc
gcccccttctctgcagatctcacaaagtggttcaacaggactgattaccccatcttcgcc
cagtaccagaggtacaggaggctccaccctctgcagcccttctacatcctgcatcctcgc
tttgagtggcagatctggcagcgaatacaggacaacatggccgagcccatccagaagaac
ccgccctcctccggcatgctcggcaccgtcctgatgatgtcgctgtgcgaggtggtgcac
gtgtacgagttcctgccgtcccggaggaagacggagctctgccattactaccagcgtttc
tacgacgccgcctgcacgctgggcgcctaccacccgctgctgtacgagaagaacctggtt
aagcgcatgaaccagggctccgaccgcgacatctacaccagcggacgcgtcacgctgccc
ggcttcaggaagctgaactgcagccagactgctggaggagaccgctga

DBGET integrated database retrieval system