KEGG   Maylandia zebra (zebra mbuna): 101466999Help
Entry
101466999         CDS       T02814                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101466999
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101466999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MKLFVLVALFGLGLAQHNPQFKNGRTAIVHLFEWRWTDIAQECERFLGPKGFGGVQISPP
NEHILVNNPFRPWWQRYQPISYKLCSRSGSEAELKDMISRCNNVGVNIYVDAVINHMCGS
GGGAGTHSSCGSWFDAGKEDFPSVPYSNLDFNDNKCKTGSGEIENYGDIYQVRDCRLVGL
LDLALEKDYVRGKVAEFMNKLINMGVAGFRVDACKHMWPGDLSAVYGRLNNLNTQWFPGG
ARPFIYQEVIDLGGEAITANEYVGLGRVTEFKYGAKLGEVFRKWNNQKLSYTNNGDGSTK
PVTINSDQTCGNGWVCEHRWRQITNMVTFRNVVNGQPHSNWWDNQGNQVAFGRGNRGFIV
FNNENWDLNVTLNTGLPGGTYCDVISGQKEGSRCTGKQVSVGGDGRATFSISGQDEDPFI
AIHADSKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttcgtcttggtggctctgttcgggcttggccttgcccagcacaacccccaa
tttaagaatggaaggactgccatcgtccacctgtttgaatggcgttggactgacattgct
caagagtgtgaacgcttcttgggtcccaaaggctttggcggagttcagatctctcctcca
aatgaacacattctggtgaacaatcccttcaggccctggtggcagagataccagccaatc
agctacaaactctgctcaagatctggcagtgaggcagaactgaaagacatgatctcccgc
tgcaacaatgttggggttaacatctatgtggatgctgttatcaaccacatgtgtggatct
ggtggcggagcaggaacccactcttcatgtggaagctggtttgatgctggcaaagaagac
ttccccagtgtcccgtattctaacttggacttcaatgacaataaatgcaagactgggagt
ggtgaaattgagaactatggtgatatatatcaggtacgtgactgccgtctggtgggtctg
ctggatcttgccctggagaaagactatgttaggggcaaagtggccgagttcatgaacaag
ctgattaacatgggtgtggctggattcagagtggatgcctgcaagcacatgtggcctggt
gatctgagtgctgtctatggtcgtctgaacaaccttaacacccagtggttccccggtggc
gccagacctttcatctatcaggaggttattgatctgggaggtgaggccattacagctaat
gagtacgtcggccttggaagagtgactgagtttaaatatggtgccaaactgggagaggtc
ttcagaaagtggaacaaccagaagctttcctacactaacaatggtgatgggtcaaccaag
cctgttactatcaactctgaccagacctgtgggaatggatgggtttgtgagcatagatgg
cgtcagatcactaacatggtcactttccgtaatgtggtcaatggacagcctcactccaac
tggtgggacaaccagggcaaccaggttgcctttgggcgtggtaaccgtggtttcatcgtt
tttaacaatgagaactgggacctgaatgtcaccctgaacacaggcttgcctggtggcacc
tactgtgatgtcatttctggtcagaaggaaggaagcagatgcactgggaagcaggtcagt
gttggtggtgatggccgtgccaccttctcaatcagtggccaagatgaggaccccttcatc
gctatccatgcagattctaagctgtaa

DBGET integrated database retrieval system