KEGG   Maylandia zebra (zebra mbuna): 101466999Help
Entry
101466999         CDS       T02814                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00500  Starch and sucrose metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101466999
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101466999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101466999
NCBI-ProteinID: XP_024661937
Position
LG18
AA seq 512 aa AA seqDB search
MKLFVLVALFGLGLAQHNPQFKHGRTSIVHLFEWRWADIARECERFLGPKGFGGVQISPP
NEHILVNNPFRPWWQRYQPVSYKLCSRSGSEAELRDMITRCNKVGVNIYVDAVINHMCGS
GGGTGTHSSCGSWFDASNEDFPSVPYSYLDFNDYKCKTGSGEIENYGDIYQVRDCRLVGM
LDLALEKDYVRGKVAEYMNKLIDIGVAGFRMDACKHMWPGDLSVVYGRLKNLNTQWFPSG
SRPFIYQEVIDLGGEAITANEYVRLGRVTEFKYGAKLGEVFRKWNNQKLSYTKNWGEGWG
FMANGNALVFTDNHDNQRGHGAGGASILTFWDPRLYKMAVGFMLAHPYGVTRVMSSYRWD
RNFVNGKDKNDWIGPPSNGDGSTKPVTINSDQTCGNGWVCEHRWRQITNMVTFRNVVNGQ
PHSNWWDNQGNQVAFGRGNRGFIVFNNEDWDLNVTLNTGMSGGTYCDVISGQKEGSKCTG
KQVTVGGDGRAHFSISGQDEDPFIAIHADSKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttcgtcttggtggctttgttcgggcttggccttgcccagcacaacccccaa
tttaagcatggaaggacttccattgtccacctgtttgagtggcgttgggctgacattgct
cgagagtgtgaacgcttcttgggtcccaaaggttttggtggagttcagatctctcctcca
aatgaacacattctggtgaacaatcccttcaggccctggtggcagagatatcagccagtc
agctacaagctctgctcaagatctggcagtgaggcagaactaagagacatgatcaccaga
tgcaacaaagttggggttaacatctatgtggatgctgtcatcaaccacatgtgtggatct
ggtggtggaacagggacccattcttcatgtggaagctggtttgacgctagcaatgaagac
ttccccagtgtcccgtattcctacttggacttcaatgactataaatgcaagactgggagt
ggtgaaattgagaactatggtgatatatatcaggtacgtgactgccgtctggtgggtatg
ctggatcttgccctggagaaagactatgttaggggcaaagtggccgagtacatgaacaag
cttattgacataggcgtggctggattcagaatggatgcctgcaaacacatgtggcctggt
gatctgagcgttgtctatggtcgtctgaaaaaccttaacacccagtggttccccagtggc
tccagacctttcatctatcaggaggttattgatctgggaggtgaggccattacagctaat
gagtatgtccgccttggaagagtgactgagtttaaatatggtgccaaactgggagaggtc
ttcagaaagtggaacaaccagaagctttcctacactaagaactggggagaaggatggggt
ttcatggctaacgggaatgctctcgtcttcactgacaaccatgataaccaaagaggccat
ggtgctggcggtgcatccatccttaccttctgggaccccaggctctacaagatggctgtt
ggtttcatgcttgcccacccttacggtgtaactagggtcatgtctagctatcggtgggac
cgcaactttgtaaatggaaaagataagaatgactggattggaccccccagcaatggtgat
gggtcaaccaagcctgttactatcaactctgaccagacctgtgggaatggatgggtttgt
gagcatagatggcgtcagatcactaacatggtcactttccgtaatgtggtcaatggacag
cctcactcaaactggtgggacaaccagggcaaccaggttgcctttgggcgtggtaatcgt
ggtttcatcgtttttaacaatgaggactgggacctgaatgtcaccctgaacacaggcatg
tctggtggcacctactgtgatgtaatttctggtcaaaaggaaggaagcaaatgtactggg
aagcaggttactgttggtggtgatggccgtgcccacttttcaatcagtggccaagatgag
gaccccttcatcgctatccatgcagattctaagctgtaa

DBGET integrated database retrieval system