KEGG   Maylandia zebra (zebra mbuna): 101467023Help
Entry
101467023         CDS       T02814                                 

Gene name
crebbp
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101467023 (crebbp)
   04330 Notch signaling pathway
    101467023 (crebbp)
   04350 TGF-beta signaling pathway
    101467023 (crebbp)
   04068 FoxO signaling pathway
    101467023 (crebbp)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101467023 (crebbp)
  Cellular community - eukaryotes
   04520 Adherens junction
    101467023 (crebbp)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101467023 (crebbp)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101467023 (crebbp)
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101467023 (crebbp)
Transcription factors [BR:mze03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101467023 (crebbp)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101467023 (crebbp)
Mitochondrial biogenesis [BR:mze03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101467023 (crebbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 2368 aa AA seqDB search
MAENLLDAGPPLSKRPKLNSPALSTSDGQDLGSLSWDDLENDLPDELIPNGGDISLMGGI
PSNGGAAPGAGGPGGTQSGLGGGSASAVPDAAAKHKQLSELLRAGTTSNIGTVSSQPGSM
GPQLGAPLGKSPLGQGSPNNHPSPQAQKAGTPTGVAGQNNNNNTATMGLNTTGFSQAMIN
NNQGHTGLLNQGGQPQPGQVMNGGLVPGAGRGRGAGVTGMQYQGQTMQGTATGQGGSGSA
LAETLTQGGQQMGAHTTLSTAQQAGNMNKMGLGSNGPFGAQSYGQGATGPGQQLNPQQQL
QNKSALANSLPPFPNELKGAAVTSVPNMQLQQQPPQQQAAMLPLAGGGGVAVPSAGPTAD
PEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVA
HCASSRQIISHWKNCTRHDCPVCLPLKNASDKRTQQPMLSSPNTGLQNSMSSVGVGQPST
PTISTSAPIDPSSMQRAYAALGLPYSSQATGQAPTQQAPGAGQTAGAPNTQAQQQLPQQM
RPISALGNQMALGNAAMGVPTSEQTNLHTDSLPNTLNTNNQLLSDGSAVGSMSSLPTAAP
VSATGSRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYE
SANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQIINQAPMAAQGTQQPVLAQPNALGPR
PQNGPIPLPNMPNQIMSRMQASQGINQFNHMTLPNAQMSQATMGPRAASPMNHPQQMNIN
SVPAMGMSPSRMPQAQGMMTGHSGGNMVGQTANQGQFLPQNQFPPGSAPAAATGAMNVTV
VPGMGQPQAQAAVTQLSQPGASLDNRVPTPASAASADLHSQHVAADLPTQEVKTETHHDQ
QEFEAAGGKTEPKMETEDESASMLAKKEEPEEKPEPMEVEEKKLEIKTEPKEEEEGGANS
TTTSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKN
PIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDP
VMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPTGGTYYSYQNRYHFCEKCFNEIQGDNVTL
GDDPAQPQTRISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICDNC
LKKSGKTRKENKFSARRLQATRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEI
KPGMKARFVDTGEMPEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYI
SYLDSIHFFRPRILRTAVYHEILIGYLEYVKKLGYAQAHIWACPPSEGDDYIFHCHPPDQ
KIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEE
SIKELEQEEEERKKEENTAASETPEGTPSDSKNAKKKNNKKTNKNKSSVSRANKKKPGMP
NVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIVDPDPLLSCDLMDGRDAFLTLA
RDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRYHCTVCEDFDLCIN
CYNTKGHEHQMVKWGLGLDDDNNSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCS
LPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLR
QQQLQHRLQQAQLMRRRMATMQCRTMPLPSPPPSAAPSTPTSHTQPSTPQTPQQPLSNQP
QTPNSAGVMSPSFSNAPRTAQAQAPVSQGKPGPQASPLHQQQSPLPQPPQPSQQLSQQPP
PIAAVKMAQRIEMMAQAQQNQRNYRVNVNGLPMNPQQPQQRMTAPMQPAMQMVPGPRGPP
VMQPGMATGQWGGASGPIQPGQTQQPGLVPGQSPQQPMTMQRAMMPPGQQPQQSQRMLIP
QQPGARPQTPQRAGAIPPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTA
KYHANQPQQQQPQQQQQAGQQQQPGMPAMQNMAMSGGAVQRTGMPPQQPQQPQVQGMAAL
GTQGQLNTAHNANPQIQEIFRRQLLLQQQQQQQQQQQGVLPQSHPGQFAAQSQGTTPTYS
QLRMQQQQQQQMQMQAGAPGGPMGQLPPMAQMAQSGMGMDSTQNLLHQRLLQQQQQLPQQ
QAVLKQQMGSPGQPSPMSPQTHLLAGQTQSGAHLPSQPALANALSNQVRSPAPVQSPCPP
SQQPPHSSPSPQVQNQPQPSPQHPPHSGSPHTGLGGPLQSMEQGHLGTPEQSAMLPQLNT
PNRGGLSNDLGMVGDATGDTLEKFVEGL
NT seq 7107 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacctgctggacgccggacctccactctctaagcggccgaagctgaattca
cctgcactgtcaacgtctgatggacaagatcttgggtcactctcctgggacgatttggag
aatgaccttccagatgagttgatccccaatggaggtgatattagcctgatgggcgggatc
ccttcaaatggtggagcagcacctggagctggcggaccaggaggcactcagtcaggactt
ggcggtggcagtgcctctgccgtcccagatgcagcggccaagcacaagcagctctcagag
ctgcttcgggctggtactacttctaatataggcacagttagctctcagccaggcagcatg
gggccacagttaggagcaccactgggtaagagccctcttggccagggctcccccaacaac
cacccgtcccctcaggcccaaaaagcaggaaccccaactggagtagcaggacagaacaac
aacaacaatactgcaactatgggcttaaacacaactgggttcagtcaggccatgattaac
aacaaccagggccatactggactcctgaaccagggagggcagccgcagcctgggcaagtg
atgaatggtggccttgtacctggagctgggagaggacgtggggcaggggtaacaggcatg
cagtaccagggacagacaatgcagggaactgcaacaggacaaggaggatcaggtagtgca
ttggcagagacgctcacacagggagggcaacagatgggagctcacactaccctcagtact
gctcagcaagcaggcaacatgaacaagatgggcctgggtagtaatggtccgttcggggcg
cagtcctatggtcagggagctacaggacctggccagcagctaaaccctcagcagcagctc
cagaacaagtctgcccttgccaacagcctgccacccttccctaatgagctcaaaggagct
gctgttactagcgtgccaaacatgcagctccagcagcagccgcctcagcagcaggcagcg
atgctcccgctggctggcggcggaggtgtggcagtgccttcggcaggccccacagccgac
cctgagaagcgcaagctgatccagcagcagctggtcctgctgctccacgcacataaatgc
cagcgacgagaacaggctaatggggaagtgagggcctgcgccctgcctcactgccgcact
atgaagaacgtccttaatcacatgacgcactgccaggctggcaaatcctgccaggtggct
cactgtgcgtcgtccagacagatcatctcccactggaaaaattgcactcgacacgactgt
cccgtctgcctgccgctgaagaatgccagcgacaagcgcacccaacagcccatgctaagc
tccccgaatacaggcctccagaactccatgtcctctgtaggcgtgggccagcctagtact
cccaccattagtacctcagcccccatagaccccagctcaatgcagagagcttatgcggca
cttgggctgccctacagcagtcaggccactggacaggctccaacccagcaggctccaggc
gcaggacagacagcaggtgcaccgaacacccaggctcaacaacaacttccacagcagatg
agacccatcagtgcacttggtaaccagatggctcttggaaatgcagcaatgggtgtgccc
acttcagaacagacaaacctgcacacagactcccttcccaacacactcaacactaacaat
cagctgctgtcagatgggtcagctgtgggctcaatgagcagcctacccacagcagcacct
gtctctgccacaggctccaggaaagcctggcatgagcacgtcactcaggacttgcgcaat
cacctcgtacacaaactagtacaagccatattccctacccctgatccggcagctttgaag
gacagacgaatggagaacttagtggcctacgccagaaaggtggaaggtgatatgtatgag
tcagctaacagccgggacgagtactatcactttttggctgagaaaatatacaaaatccaa
aaagagttggaggagaagaggcgttcaaggcttcagaaacagatcatcaaccaggcacct
atggctgcccagggaacccagcaaccagtcctagcccagcccaatgccttgggcccacga
ccacagaatggacctattcctcttcccaacatgccaaatcagatcatgagtcgcatgcag
gcttcacaaggaatcaaccagttcaaccacatgactctacccaatgcccagatgtctcaa
gcaacaatgggaccccgtgctgcctcacccatgaatcaccctcaacagatgaacataaac
tcagtcccagcgatgggaatgtctccctctaggatgccccaggcccagggcatgatgact
ggacacagtggaggaaacatggtgggtcagactgccaaccagggtcagtttttgcctcag
aaccagtttcctccaggatctgctccagctgctgcaacgggtgcgatgaatgtcacagtg
gtgccaggcatgggtcagccacaggcacaggctgctgtcactcagctgtctcagccagga
gccagtctggataatcgggtgcccacaccagcctcagccgccagcgccgacctgcactcg
cagcatgttgcagcagacctgcctacccaagaggtcaaaacggagacgcaccatgatcaa
caggaatttgaggctgctggtggaaaaactgagcccaagatggagactgaagatgagtct
gcttcaatgttggccaagaaggaagagccagaggaaaagccggagcccatggaggtggag
gagaagaagctggaaattaagacggaacccaaagaagaggaagagggtggagctaacagc
acaaccacctcatccccatctcagtcacggcggaaaatttttaaacccgaggagttgcgc
caggctctgatgccaactctggagagtctgtacaggcaggaccccgagtccctgcccttt
agacaaccagtagaccctatgctcttgggtatcccggattactttgacattgtgaagaat
ccaatagacttgtccacaataaagcgcaagcttgacacaggccagtaccaggagccctgg
caatatgtggatgatgtctggctgatgttcaacaacgcctggctctacaaccgcaaaaca
tcccgtgtctacaagtactgctctaagctggctgaggtgtttgagtccgagattgaccct
gtcatgcagggcctgggctactgctgtgggagaaagtacgagttctcccctcaaaccctc
tgttgttatggcaagcagctctgcaccatacctactggaggcacatactacagttaccag
aacaggtatcatttctgtgaaaaatgtttcaatgagatccagggggataatgtgacgtta
ggagatgatcctgcacaaccacagacgaggatatcgaaagaccagtttgagcggaagaag
aacgatgtcctcgaccctgaaccgtttgttgaatgtaaagattgtggacggaagatgcac
caaatatgcgtcttacactacgaggtcatttggccatctggatttatctgtgacaactgt
ttgaagaaaagtggaaaaacacgaaaggaaaacaagttctcagcaagaaggctgcaagca
acacgactgggaacgtacatagaggaccgtgtgaataaatacttgaagcgacaaaaccac
ccagaggctggggaagtgtttgtacgagtggtggcaagctctgataaaacggtggagatt
aaaccaggcatgaaagctaggtttgtagatacaggtgaaatgccagaggcctttccttat
agaaccaaagcacttttcgcatttgaggaaattgatggtgtagacgtgtgcttcttcggc
atgcacgtacaggagtatggctctgagtgcccattccccaacactagacgggtctacata
tcataccttgacagtattcacttcttcagacctcggattctacgaacagccgtttaccat
gagatccttattggctatctagaatatgtcaagaaacttggatatgcccaggcccacatc
tgggcatgtcctcccagtgaaggtgacgactatatctttcactgccatcctcctgaccag
aagatccccaagcctaaaagactgcaggagtggtacaggaagatgttggacaaggctttt
gctgagaggatcctgcatgactacaaggatatcttcaaacaggcaactgaagaccgactg
accagcgccaatgagctgccttactttgaaggtgacttctggcctaatgtgcttgaagag
agcatcaaggagctggagcaggaggaagaagagcggaagaaggaggagaacacagctgcc
tctgaaactccagagggaacaccaagtgacagtaaaaacgctaagaagaagaacaacaag
aagaccaataaaaacaagagcagcgtgagccgagccaataagaagaagcctgggatgcca
aatgtagctaatgatttgtctcagaagttgtacgccaccatggagaagcataaagaggtg
ttcttcgtgattcaccttcattctgggcccatggtcaacactttgccgcccatcgtggac
cccgacccattgctctcctgtgacctgatggatggccgtgatgccttcctgactctggca
agggacaagcactgggagttcagctccctcaggaggtgcaagtggagcaccatgtgcatg
ctcgttgaactgcacaaccagggacaggatcgttttgtctatacttgtaacgagtgcaag
caccacgtggagacacgctaccattgcactgtgtgcgaggactttgatctttgcattaat
tgctacaacacaaagggccatgagcaccagatggtcaagtggggtcttggcctggatgat
gataacaacagccagagtggggaggcctccaagagcccacaggagagccggcgtttaagt
attcaacggtgcattcagtcgctggtccatgcttgtcagtgtcgcaatgccaactgctct
ctgccgtcctgccagaagatgaagcgagtggtacagcacaccaagggttgcaaacgcaaa
accaacggtggctgtcctgtatgtaagcagcttattgctttatgctgttatcacgcaaag
cactgccaggagaacaagtgtcctgtcccgttctgcctgaacatcaagcacaagcttcgc
cagcagcagctgcagcacaggctccagcaggcccagttgatgaggagaagaatggccacc
atgcaatgcagaaccatgccgctaccatccccaccgccatcagctgcccctagcactccc
acttcccacactcagcccagcactccccaaacaccccagcagcctctttccaaccagccg
cagacccccaactcagcaggcgtcatgtcgccgtctttctccaatgcacctcgcactgcc
caagctcaggcaccggtgtctcagggcaaacctgggccccaggcctcccctctacaccag
cagcagtcccctctccctcagcccccccaaccatcacagcagctatctcagcagccacct
cccatcgctgcagtcaagatggcacagcgcatcgaaatgatggcgcaggcccagcagaac
cagcggaactaccgtgtcaatgtgaatggtttgcccatgaatccccagcagccacaacag
cgcatgacagcaccaatgcagccagcaatgcagatggtgcctgggccccggggaccacca
gtcatgcaacctggtatggccactggacagtggggtggagcttcaggccccatccagcca
ggtcaaactcaacaaccaggtcttgttccaggccagtccccacagcagcccatgaccatg
cagcgagccatgatgccaccagggcagcaaccccagcaaagccagaggatgctgatacca
cagcagcccggtgcccggccacagactccccagagagctggagctatacctccaaatgct
ctgcaggacctcctccgcaccctaaagtctcccagctcaccccagcagcagcagcaagtt
ctaaacatcctcaaatcaaaccctcagctaatggctgcgttcattaaacagcgaacagcc
aagtaccatgccaaccagccgcagcagcaacaaccgcaacagcagcaacaagcaggccaa
caacagcagcctggcatgccagcaatgcagaatatggctatgtctggaggggcagtgcaa
aggacggggatgccaccacagcaaccacagcagcctcaagtgcagggcatggctgcatta
gggactcaagggcagctgaacaccgcgcacaatgcaaacccccagatccaggagattttc
cgcaggcaactcttattgcagcagcaacaacagcagcagcagcaacagcagggagtgtta
ccacagagccacccgggtcagtttgctgctcagtcgcagggtacaacacccacctactcc
cagctccgaatgcaacagcaacaacagcagcaaatgcaaatgcaggcaggggcacctggg
ggccccatgggtcagctcccaccaatggctcagatggcccagtctggcatggggatggac
tcgacccaaaatttactgcatcaacgactgcttcagcagcagcagcaacttccccagcag
caggctgtcctaaagcagcagatgggctcccctggccaaccaagccccatgagccctcaa
acccacctcctggctgggcagactcaaagcggagcccacctccccagccaacctgcttta
gccaacgccctcagcaaccaggtccgctccccagcaccagtccagtccccttgtccaccc
tcgcagcagcccccacattccagtccttcgccgcaggtccagaaccagccccaaccctca
cctcagcacccaccccactcgggttcaccccacacagggcttgggggcccactgcagtcg
atggagcaaggacacttggggacaccagaacaaagcgccatgctaccgcagcttaatacg
cccaacagaggagggctgagcaatgacttggggatggtaggagatgctacaggggacact
ctggagaagtttgtggagggattgtag

DBGET integrated database retrieval system