KEGG   Maylandia zebra (zebra mbuna): 101467023Help
Entry
101467023         CDS       T02814                                 

Definition
CREB-binding protein-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101467023
   04330 Notch signaling pathway
    101467023
   04350 TGF-beta signaling pathway
    101467023
   04630 Jak-STAT signaling pathway
    101467023
   04068 FoxO signaling pathway
    101467023
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101467023
  Cell communication
   04520 Adherens junction
    101467023
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101467023
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101467023
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101467023
Transcription factors [BR:mze03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101467023
Mitochondrial biogenesis [BR:mze03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101467023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2368 aa AA seqDB search
MAENLLDAGPPLSKRPKLNSPALSTSDGQDLGSLSWDDLENDLPDELIPNGGDISLMGGI
PSNGGAAPGAGGPGGTQSGLGGGSASAVPDAAAKHKQLSELLRAGTTSNIGTVSSQPGSM
GPQLGAPLGKSPLGQGSPNNHPSPQAQKAGTPTGVAGQNNNNNTATMGLNTTGFSQAMIN
NNQGHTGLLNQGGQPQPGQVMNGGLVPGAGRGRGAGVTGMQYQGQTMQGTATGQGGSGSA
LAETLTQGGQQMGAHTTLSTAQQAGNMNKMGLGSNGPFGAQSYGQGATGPGQQLNPQQQL
QNKSALANSLPPFPNELKGAAVTSVPNMQLQQQPPQQQAAMLPLAGGGGVAVPSAGPTAD
PEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVA
HCASSRQIISHWKNCTRHDCPVCLPLKNASDKRTQQPMLSSPNTGLQNSMSSVGVGQPST
PTISTSAPIDPSSMQRAYAALGLPYSSQATGQAPTQQAPGAGQTAGAPNTQAQQQLPQQM
RPISALGNQMALGNAAMGVPTSEQTNLHTDSLPNTLNTNNQLLSDGSAVGSMSSLPTAAP
VSATGSRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYE
SANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQIINQAPMAAQGTQQPVLAQPNALGPR
PQNGPIPLPNMPNQIMSRMQASQGINQFNHMTLPNAQMSQATMGPRAASPMNHPQQMNIN
SVPAMGMSPSRMPQAQGMMTGHSGGNMVGQTANQGQFLPQNQFPPGSAPAAATGAMNVTV
VPGMGQPQAQAAVTQLSQPGASLDNRVPTPASAASADLHSQHVAADLPTQEVKTETHHDQ
QEFEAAGGKTEPKMETEDESASMLAKKEEPEEKPEPMEVEEKKLEIKTEPKEEEEGGANS
TTTSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKN
PIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDP
VMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPTGGTYYSYQNRYHFCEKCFNEIQGDNVTL
GDDPAQPQTRISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICDNC
LKKSGKTRKENKFSARRLQATRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEI
KPGMKARFVDTGEMPEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYI
SYLDSIHFFRPRILRTAVYHEILIGYLEYVKKLGYAQAHIWACPPSEGDDYIFHCHPPDQ
KIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEE
SIKELEQEEEERKKEENTAASETPEGTPSDSKNAKKKNNKKTNKNKSSVSRANKKKPGMP
NVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIVDPDPLLSCDLMDGRDAFLTLA
RDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRYHCTVCEDFDLCIN
CYNTKGHEHQMVKWGLGLDDDNNSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCS
LPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLR
QQQLQHRLQQAQLMRRRMATMQCRTMPLPSPPPSAAPSTPTSHTQPSTPQTPQQPLSNQP
QTPNSAGVMSPSFSNAPRTAQAQAPVSQGKPGPQASPLHQQQSPLPQPPQPSQQLSQQPP
PIAAVKMAQRIEMMAQAQQNQRNYRVNVNGLPMNPQQPQQRMTAPMQPAMQMVPGPRGPP
VMQPGMATGQWGGASGPIQPGQTQQPGLVPGQSPQQPMTMQRAMMPPGQQPQQSQRMLIP
QQPGARPQTPQRAGAIPPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTA
KYHANQPQQQQPQQQQQAGQQQQPGMPAMQNMAMSGGAVQRTGMPPQQPQQPQVQGMAAL
GTQGQLNTAHNANPQIQEIFRRQLLLQQQQQQQQQQQGVLPQSHPGQFAAQSQGTTPTYS
QLRMQQQQQQQMQMQAGAPGGPMGQLPPMAQMAQSGMGMDSTQNLLHQRLLQQQQQLPQQ
QAVLKQQMGSPGQPSPMSPQTHLLAGQTQSGAHLPSQPALANALSNQVRSPAPVQSPCPP
SQQPPHSSPSPQVQNQPQPSPQHPPHSGSPHTGLGGPLQSMEQGHLGTPEQSAMLPQLNT
PNRGGLSNDLGMVGDATGDTLEKFVEGL
NT seq 7107 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacctgctggacgccggacctccactctctaagcggccgaagctgaattca
cctgcactgtcaacgtctgatggacaagatcttgggtcactctcctgggacgatttggag
aatgaccttccagatgagttgatccccaatggaggtgatattagcctgatgggcgggatc
ccttcaaatggtggagcagcacctggagctggcggaccaggaggcactcagtcaggactt
ggcggtggcagtgcctctgccgtcccagatgcagcggccaagcacaagcagctctcagag
ctgcttcgggctggtactacttctaatataggcacagttagctctcagccaggcagcatg
gggccacagttaggagcaccactgggtaagagccctcttggccagggctcccccaacaac
cacccgtcccctcaggcccaaaaagcaggaaccccaactggagtagcaggacagaacaac
aacaacaatactgcaactatgggcttaaacacaactgggttcagtcaggccatgattaac
aacaaccagggccatactggactcctgaaccagggagggcagccgcagcctgggcaagtg
atgaatggtggccttgtacctggagctgggagaggacgtggggcaggggtaacaggcatg
cagtaccagggacagacaatgcagggaactgcaacaggacaaggaggatcaggtagtgca
ttggcagagacgctcacacagggagggcaacagatgggagctcacactaccctcagtact
gctcagcaagcaggcaacatgaacaagatgggcctgggtagtaatggtccgttcggggcg
cagtcctatggtcagggagctacaggacctggccagcagctaaaccctcagcagcagctc
cagaacaagtctgcccttgccaacagcctgccacccttccctaatgagctcaaaggagct
gctgttactagcgtgccaaacatgcagctccagcagcagccgcctcagcagcaggcagcg
atgctcccgctggctggcggcggaggtgtggcagtgccttcggcaggccccacagccgac
cctgagaagcgcaagctgatccagcagcagctggtcctgctgctccacgcacataaatgc
cagcgacgagaacaggctaatggggaagtgagggcctgcgccctgcctcactgccgcact
atgaagaacgtccttaatcacatgacgcactgccaggctggcaaatcctgccaggtggct
cactgtgcgtcgtccagacagatcatctcccactggaaaaattgcactcgacacgactgt
cccgtctgcctgccgctgaagaatgccagcgacaagcgcacccaacagcccatgctaagc
tccccgaatacaggcctccagaactccatgtcctctgtaggcgtgggccagcctagtact
cccaccattagtacctcagcccccatagaccccagctcaatgcagagagcttatgcggca
cttgggctgccctacagcagtcaggccactggacaggctccaacccagcaggctccaggc
gcaggacagacagcaggtgcaccgaacacccaggctcaacaacaacttccacagcagatg
agacccatcagtgcacttggtaaccagatggctcttggaaatgcagcaatgggtgtgccc
acttcagaacagacaaacctgcacacagactcccttcccaacacactcaacactaacaat
cagctgctgtcagatgggtcagctgtgggctcaatgagcagcctacccacagcagcacct
gtctctgccacaggctccaggaaagcctggcatgagcacgtcactcaggacttgcgcaat
cacctcgtacacaaactagtacaagccatattccctacccctgatccggcagctttgaag
gacagacgaatggagaacttagtggcctacgccagaaaggtggaaggtgatatgtatgag
tcagctaacagccgggacgagtactatcactttttggctgagaaaatatacaaaatccaa
aaagagttggaggagaagaggcgttcaaggcttcagaaacagatcatcaaccaggcacct
atggctgcccagggaacccagcaaccagtcctagcccagcccaatgccttgggcccacga
ccacagaatggacctattcctcttcccaacatgccaaatcagatcatgagtcgcatgcag
gcttcacaaggaatcaaccagttcaaccacatgactctacccaatgcccagatgtctcaa
gcaacaatgggaccccgtgctgcctcacccatgaatcaccctcaacagatgaacataaac
tcagtcccagcgatgggaatgtctccctctaggatgccccaggcccagggcatgatgact
ggacacagtggaggaaacatggtgggtcagactgccaaccagggtcagtttttgcctcag
aaccagtttcctccaggatctgctccagctgctgcaacgggtgcgatgaatgtcacagtg
gtgccaggcatgggtcagccacaggcacaggctgctgtcactcagctgtctcagccagga
gccagtctggataatcgggtgcccacaccagcctcagccgccagcgccgacctgcactcg
cagcatgttgcagcagacctgcctacccaagaggtcaaaacggagacgcaccatgatcaa
caggaatttgaggctgctggtggaaaaactgagcccaagatggagactgaagatgagtct
gcttcaatgttggccaagaaggaagagccagaggaaaagccggagcccatggaggtggag
gagaagaagctggaaattaagacggaacccaaagaagaggaagagggtggagctaacagc
acaaccacctcatccccatctcagtcacggcggaaaatttttaaacccgaggagttgcgc
caggctctgatgccaactctggagagtctgtacaggcaggaccccgagtccctgcccttt
agacaaccagtagaccctatgctcttgggtatcccggattactttgacattgtgaagaat
ccaatagacttgtccacaataaagcgcaagcttgacacaggccagtaccaggagccctgg
caatatgtggatgatgtctggctgatgttcaacaacgcctggctctacaaccgcaaaaca
tcccgtgtctacaagtactgctctaagctggctgaggtgtttgagtccgagattgaccct
gtcatgcagggcctgggctactgctgtgggagaaagtacgagttctcccctcaaaccctc
tgttgttatggcaagcagctctgcaccatacctactggaggcacatactacagttaccag
aacaggtatcatttctgtgaaaaatgtttcaatgagatccagggggataatgtgacgtta
ggagatgatcctgcacaaccacagacgaggatatcgaaagaccagtttgagcggaagaag
aacgatgtcctcgaccctgaaccgtttgttgaatgtaaagattgtggacggaagatgcac
caaatatgcgtcttacactacgaggtcatttggccatctggatttatctgtgacaactgt
ttgaagaaaagtggaaaaacacgaaaggaaaacaagttctcagcaagaaggctgcaagca
acacgactgggaacgtacatagaggaccgtgtgaataaatacttgaagcgacaaaaccac
ccagaggctggggaagtgtttgtacgagtggtggcaagctctgataaaacggtggagatt
aaaccaggcatgaaagctaggtttgtagatacaggtgaaatgccagaggcctttccttat
agaaccaaagcacttttcgcatttgaggaaattgatggtgtagacgtgtgcttcttcggc
atgcacgtacaggagtatggctctgagtgcccattccccaacactagacgggtctacata
tcataccttgacagtattcacttcttcagacctcggattctacgaacagccgtttaccat
gagatccttattggctatctagaatatgtcaagaaacttggatatgcccaggcccacatc
tgggcatgtcctcccagtgaaggtgacgactatatctttcactgccatcctcctgaccag
aagatccccaagcctaaaagactgcaggagtggtacaggaagatgttggacaaggctttt
gctgagaggatcctgcatgactacaaggatatcttcaaacaggcaactgaagaccgactg
accagcgccaatgagctgccttactttgaaggtgacttctggcctaatgtgcttgaagag
agcatcaaggagctggagcaggaggaagaagagcggaagaaggaggagaacacagctgcc
tctgaaactccagagggaacaccaagtgacagtaaaaacgctaagaagaagaacaacaag
aagaccaataaaaacaagagcagcgtgagccgagccaataagaagaagcctgggatgcca
aatgtagctaatgatttgtctcagaagttgtacgccaccatggagaagcataaagaggtg
ttcttcgtgattcaccttcattctgggcccatggtcaacactttgccgcccatcgtggac
cccgacccattgctctcctgtgacctgatggatggccgtgatgccttcctgactctggca
agggacaagcactgggagttcagctccctcaggaggtgcaagtggagcaccatgtgcatg
ctcgttgaactgcacaaccagggacaggatcgttttgtctatacttgtaacgagtgcaag
caccacgtggagacacgctaccattgcactgtgtgcgaggactttgatctttgcattaat
tgctacaacacaaagggccatgagcaccagatggtcaagtggggtcttggcctggatgat
gataacaacagccagagtggggaggcctccaagagcccacaggagagccggcgtttaagt
attcaacggtgcattcagtcgctggtccatgcttgtcagtgtcgcaatgccaactgctct
ctgccgtcctgccagaagatgaagcgagtggtacagcacaccaagggttgcaaacgcaaa
accaacggtggctgtcctgtatgtaagcagcttattgctttatgctgttatcacgcaaag
cactgccaggagaacaagtgtcctgtcccgttctgcctgaacatcaagcacaagcttcgc
cagcagcagctgcagcacaggctccagcaggcccagttgatgaggagaagaatggccacc
atgcaatgcagaaccatgccgctaccatccccaccgccatcagctgcccctagcactccc
acttcccacactcagcccagcactccccaaacaccccagcagcctctttccaaccagccg
cagacccccaactcagcaggcgtcatgtcgccgtctttctccaatgcacctcgcactgcc
caagctcaggcaccggtgtctcagggcaaacctgggccccaggcctcccctctacaccag
cagcagtcccctctccctcagcccccccaaccatcacagcagctatctcagcagccacct
cccatcgctgcagtcaagatggcacagcgcatcgaaatgatggcgcaggcccagcagaac
cagcggaactaccgtgtcaatgtgaatggtttgcccatgaatccccagcagccacaacag
cgcatgacagcaccaatgcagccagcaatgcagatggtgcctgggccccggggaccacca
gtcatgcaacctggtatggccactggacagtggggtggagcttcaggccccatccagcca
ggtcaaactcaacaaccaggtcttgttccaggccagtccccacagcagcccatgaccatg
cagcgagccatgatgccaccagggcagcaaccccagcaaagccagaggatgctgatacca
cagcagcccggtgcccggccacagactccccagagagctggagctatacctccaaatgct
ctgcaggacctcctccgcaccctaaagtctcccagctcaccccagcagcagcagcaagtt
ctaaacatcctcaaatcaaaccctcagctaatggctgcgttcattaaacagcgaacagcc
aagtaccatgccaaccagccgcagcagcaacaaccgcaacagcagcaacaagcaggccaa
caacagcagcctggcatgccagcaatgcagaatatggctatgtctggaggggcagtgcaa
aggacggggatgccaccacagcaaccacagcagcctcaagtgcagggcatggctgcatta
gggactcaagggcagctgaacaccgcgcacaatgcaaacccccagatccaggagattttc
cgcaggcaactcttattgcagcagcaacaacagcagcagcagcaacagcagggagtgtta
ccacagagccacccgggtcagtttgctgctcagtcgcagggtacaacacccacctactcc
cagctccgaatgcaacagcaacaacagcagcaaatgcaaatgcaggcaggggcacctggg
ggccccatgggtcagctcccaccaatggctcagatggcccagtctggcatggggatggac
tcgacccaaaatttactgcatcaacgactgcttcagcagcagcagcaacttccccagcag
caggctgtcctaaagcagcagatgggctcccctggccaaccaagccccatgagccctcaa
acccacctcctggctgggcagactcaaagcggagcccacctccccagccaacctgcttta
gccaacgccctcagcaaccaggtccgctccccagcaccagtccagtccccttgtccaccc
tcgcagcagcccccacattccagtccttcgccgcaggtccagaaccagccccaaccctca
cctcagcacccaccccactcgggttcaccccacacagggcttgggggcccactgcagtcg
atggagcaaggacacttggggacaccagaacaaagcgccatgctaccgcagcttaatacg
cccaacagaggagggctgagcaatgacttggggatggtaggagatgctacaggggacact
ctggagaagtttgtggagggattgtag

DBGET integrated database retrieval system