KEGG   Maylandia zebra (zebra mbuna): 101467156Help
Entry
101467156         CDS       T02814                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101467156
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101467156
  Energy metabolism
   00190 Oxidative phosphorylation
    101467156
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101467156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 283 aa AA seqDB search
MSVASFTSLTRCGVLAFRSPAGLLAVRYAQTAAAPAGQPRVKKFQVYRWDPETPGDKPRM
QTYEIDLNTCGPMVLDVLIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKID
SSLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKEGKEQYLQSVEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEYTEERLSKLQDPF
SLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKKKTAAAV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgccagttttacgtccttgactcggtgcggtgttttggcattccgctctccc
gcaggactcttggcggtacggtatgcacagacagcagcagctccagcagggcagcccagg
gtaaagaagttccaggtgtacagatgggatccagaaactccaggggacaaaccccgaatg
cagacctatgagattgacctcaacacctgtggcccaatggttctcgatgtgctcattaag
atcaagaatgagattgaccccactctgacatttcgtcgctcctgcagagaaggtatttgt
gggtcctgtgcgatgaacatcaatggaggaaacacactcgcctgcctcaacaagatcgac
tccagcctcagcaagccgactaagatttaccctctgccacacatgtacgtcgtcaaggac
ctggtacctgacatgagtaacttctacgcccagtacaagtccatcgaaccctacctgaag
aagaaggatgagtccaaggaagggaaggaacagtacctgcagtctgtggaggaccgggag
aagctggacgggctgtatgagtgtattctgtgcgcctgttgcagcaccagctgcccaagt
tactggtggaacggagacaaatacctcgggcctgctgtgctcatgcaggcgtaccgctgg
atgattgactcacgagacgagtacacagaagaacggttgtccaagctgcaggatcctttc
tcgctctaccgttgccacaccatcatgaactgcaccaagacctgtcccaagggcctgaac
ccaggaaaagctatcgctgagatcaagaagatgatggccacatacaagaagaagacagca
gctgctgtctga

DBGET integrated database retrieval system