KEGG   Maylandia zebra (zebra mbuna): 101468593Help
Entry
101468593         CDS       T02814                                 

Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101468593
Peptidases [BR:mze01002]
 Cysteine Peptidases
  Family C86
   101468593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 264 aa AA seqDB search
MGSAPYPAGEWKGKGRGSLQELGCMPWKVSKQKGGGGSGGGGGGEAVVGAEEKRSRDPRE
TQQQDLSSSSSSLTSPAPPQASLVPPAIYHEKQRRELCALHALNNVFQDGTAFSRDTLQE
IYQRLSPSTMVTPHKKSMLGNGNYDVNVIMAALQTRGFEAVWWDKRRDVGNIELSNVEGF
ILNVPSNLRWGPLRLPLKRQHWIGVREVGGVYYNLDSKLRSPQPIGNPDELRKFLHQQLR
GKNCELLLVVSEEVEAHQTWRSDG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgctccgtatccagccggtgagtggaaggggaaggggcgaggcagcctgcag
gagctggggtgcatgccctggaaggtcagcaaacagaaaggtggtggaggaagtggaggg
ggaggaggaggggaggcggtggtgggagcagaggagaagaggtccagggatcccagggaa
actcagcagcaagatctctcatcgtcctcttcttcactcacctcgccagctcctccccaa
gcttctttggtgcctccggccatttatcacgaaaagcaacggcgggagctgtgtgccctg
cacgcactcaataacgtcttccaggatgggacagccttcagccgagacaccctgcaggag
atctaccagaggctctctcccagcactatggtgacgcctcacaaaaagagcatgctggga
aacgggaactatgacgtcaatgtcattatggcagccctgcagacccgagggtttgaggca
gtttggtgggataaaagaagggatgttggcaatattgaactgtccaacgtggagggcttc
atcctgaacgtaccgtccaatctgcgctgggggcccctccggttgccgcttaagcgccag
cactggataggcgtcagagaggtgggaggagtctactacaacttggactccaagctacgt
agccctcaaccaattggcaatccggatgagctcaggaagtttctccaccagcagctacga
gggaagaactgtgaactcctgctagtcgtctcagaggaagtggaggcgcaccagacatgg
cgatctgatggctaa

DBGET integrated database retrieval system