KEGG   Maylandia zebra (zebra mbuna): 101468749Help
Entry
101468749         CDS       T02814                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101468749
   00051 Fructose and mannose metabolism
    101468749
Enzymes [BR:mze01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     101468749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 545 aa AA seqDB search
MMENSFFGTRRVVKTMDDARRIFHEFHSCPIGGHTGIQKTLAAVCSGFYWFSMTVDIKNW
ILEWDQCQKDGNPLAAVQPLQCIKRPRSGTNEGGRQKKLAPAGRARSADRKMAAQEKFFA
GIPKIQYKPDAGPGDVMCFKHYSAEEVLMGRTMEDWLRFSVCYWHSFCGPGAGPFGVPTH
HRLWNKGSPMKSARKRLCAAFEFFTKLGVKYYTFHDRDIAPEGSTLEESNRNLDEITDLA
LKLQNQTGVKLLWITCNLFTHLRYMNGAATNPDCHVLAYAGAQVKKSLEIAKKLGAENFV
FWGGRGFHSIHNTDVAVELNHMAIFFKMAVNYKEKIGLSCQFLIAPQQKEPSKHQYDYDA
MSLIGFLKHFGLDSDFKLKIEPNHTTLGGHDIVMASAFGMLGSIDSNTGYPYLGWDTDQC
PLDIRNTTLVMKVIVEQGGLHPGGLNFVAKAHIESTDLEDLFISHIRVIDAFARGLRNAV
HIIEDGVIASMMQERYSSFSHGLGQKVENGTATLEEMEDFIKQNGEPEVTSGKQEKYDSV
FNHYI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaactctttttttggaaccagaagagtagttaaaaccatggacgatgccagg
aggatctttcatgagtttcattcatgtccaataggaggacacactggcatacagaaaacg
ctagcagcagtgtgttccggattttactggtttagtatgacggttgacattaaaaattgg
attctggaatgggaccagtgtcaaaaagatgggaacccactggctgctgtgcagccgttg
cagtgtattaagaggccgcgtagtggaaccaacgagggaggaagacaaaagaaattagcg
cctgctggcagggctcgtagtgcggaccgaaaaatggcagcgcaggagaagttctttgca
ggaattcccaaaatccagtataaacccgatgctggacctggtgatgtcatgtgttttaaa
cactacagtgcagaagaggtgctgatggggaggacgatggaggactggttgaggttttca
gtctgctactggcactctttctgtggaccgggtgccggtccttttggagttccaacccac
caccggctctggaataaagggtctcctatgaaatcagccaggaagcgactctgtgcagcc
tttgagtttttcaccaagcttggagtaaaatattacactttccatgacagagacattgcc
cctgagggctccacgctggaggagtccaaccgcaatctggatgaaataacagacctggct
ctcaagctacagaaccagactggagtgaagttgctgtggatcacctgtaacctctttact
cacttaaggtacatgaatggtgcagccactaaccctgactgccatgtgctggcctatgct
ggtgctcaggtgaaaaaaagtctggaaatcgccaagaagctgggtgcagaaaactttgtt
ttttggggaggaagaggtttccactccatccataacactgatgttgctgttgaactcaat
cacatggccatcttcttcaaaatggctgtcaactacaaagagaagattgggttgagttgt
cagtttctgattgcgccccaacaaaaggagcccagcaaacaccagtatgattacgatgca
atgagtcttataggattcctaaagcattttggtttggacagtgactttaagttaaaaatt
gagcccaaccacaccactctaggaggacacgatattgtcatggcatctgcttttgggatg
ctgggatcgattgactccaacacaggctatccttacctggggtgggacacagatcagtgc
cccctggacatcaggaacaccaccttggtcatgaaagtgattgttgaacaaggcggcctg
catccaggaggattgaactttgttgcaaaggcgcacatagagtccactgacctcgaggac
ctgttcattagtcacatcagagtcatagacgcctttgcaagaggactcaggaacgccgtt
cacatcattgaggatggggttattgctagtatgatgcaggagcggtactcaagctttagt
catggcctcggacagaaggtggagaatggtactgccaccttagaggagatggaggatttc
atcaagcagaacggtgagccagaagtaacatcagggaagcaagaaaagtatgactccgtc
tttaaccactacatatga

DBGET integrated database retrieval system