KEGG   Maylandia zebra (zebra mbuna): 101469095Help
Entry
101469095         CDS       T02814                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze04012  ErbB signaling pathway
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04210  Apoptosis
mze04218  Cellular senescence
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04620  Toll-like receptor signaling pathway
mze04625  C-type lectin receptor signaling pathway
mze04810  Regulation of actin cytoskeleton
mze04910  Insulin signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04933  AGE-RAGE signaling pathway in diabetic complications
Module
mze_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101469095 (pik3cd)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101469095 (pik3cd)
   04370 VEGF signaling pathway
    101469095 (pik3cd)
   04068 FoxO signaling pathway
    101469095 (pik3cd)
   04070 Phosphatidylinositol signaling system
    101469095 (pik3cd)
   04150 mTOR signaling pathway
    101469095 (pik3cd)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101469095 (pik3cd)
  Cell growth and death
   04210 Apoptosis
    101469095 (pik3cd)
   04218 Cellular senescence
    101469095 (pik3cd)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101469095 (pik3cd)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101469095 (pik3cd)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101469095 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    101469095 (pik3cd)
  Endocrine system
   04910 Insulin signaling pathway
    101469095 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    101469095 (pik3cd)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101469095 (pik3cd)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101469095 (pik3cd)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101469095 (pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135 C2 DUF4037
Motif
Other DBs
NCBI-GeneID: 101469095
NCBI-ProteinID: XP_004554255
Position
LG20
AA seq 1039 aa AA seqDB search
MPPGKYGMQEEWEKEGDQAINMDFLLPTGIFLKFPVSRNDTIKSIKKMVWKNARSEALFC
GLGDPDGYVFTCINETAEREELEEESRRISDVRPFMCVLRLVAREGDRVEKLTNAQISLL
IGKGLHEFEAQKNDEVNEFRTKMRAFCEEKAQDRQSLPWQKWMEYSFPCELEPCCSLPQS
LKTKNIKKIFINVKFEASDESFMLQQDPHDLPLVLMKSALKKKATVFRLMRQEPEDYTLQ
VNGRWDFIYGKHPLCQFKYIFSCLRNGQNPHLTMVHYSTVTKCQEEQGRMCNQVYKSRSL
SRPPPLPLKKQNTSSLWSINEPFHIHLVQGKRVNADEGMKLVVQAGLFHGSELLCKVVTS
SEVTVSSEPLWNQKLEFDINVADLPRMSRLCFALYGVIEKTKKPRGTKKKNKKADCPIAW
VNTMVFDYKDQLKTGEFHLSTWPCVPDEKSDLLNPMGTVEKNPNVDSAAELLIHFPNIRP
HPLYYPPLEKICDMERNGDLSLATKDEYFKLKEFMDNKNYTEFFEDEKELLWKLRTEVRD
HYPESLSKLLLITKWNKREDVVQMVNLLRNWPDLPAIHALELLDYSFPDPAVRSFTIRCL
RKLSDDELLHYLIQLVQVLKYESYLDCDLTTFLLERALSNRRIGHFLFWHLRSETHVASV
GLRFGLILEAYCRGNIHHIKLLTKQNEALGKMKALSDFVKLGSQKVTAEDLKQCIRQESY
LEALSDLLSPLNPSIILSEICTDRCRFMDSKMKPLWLMFKNPAVEGDMVGIIFKNGDDLR
QDMLTLQMIQLMENLWKKEGLDLRMIPYGCLSTGNKMGLIEVVKNSDTIANIQRNSSNSA
ATAAFNKDALLNWLKSKNPEDKLDQAIEEFTLSCAGYCVATYVLGIGDRHNDNIMIRETG
QLFHIDFGHFLGNFKRKLGINRERVPFILTYDFVHVIQQGRTNNSEKFERFREYCERAYK
ILCRNGTLFVNLFAMMKAAGLPELTSFKDIQYLKDSLALGKTEDEALKNFKVKFNEALRE
SWKTKVNWMMHSLAKDNRP
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgcccccagggaagtatgggatgcaggaggagtgggagaaggagggggaccaggcgatc
aacatggacttcctgctgcctactgggatcttcctcaaattccccgtgtctcgaaacgac
accatcaaaagcatcaaaaagatggtttggaaaaatgcgagaagtgaggccctgttctgt
ggactcggcgatcctgatggatacgtcttcacctgcatcaacgagacggcggaaagggaa
gagctggaggaagaatcgaggcgcataagtgatgtgcggcccttcatgtgtgttctgagg
ctggtggcgagggagggcgaccgggtggagaaactcaccaacgcccaaatcagcctgtta
attggcaaaggtctgcatgagtttgaagctcagaagaatgacgaggtaaatgagtttcgg
accaagatgagggcgttttgcgaagaaaaggctcaagatcgacagagtctgccctggcag
aagtggatggagtacagcttcccatgtgaactggagccatgctgctccctgccgcagagc
ctcaagacaaaaaacatcaagaagatcttcattaatgtcaagtttgaggcttctgacgaa
agcttcatgctacagcaggaccctcatgacctccccttggttctgatgaagagcgctctg
aagaagaaggctaccgttttccgcttaatgcgacaggaacctgaagactacaccttacag
gtcaacgggaggtgggatttcatctatgggaaacacccactgtgtcagttcaaatacatc
ttctcgtgcttgagaaatggccagaacccccacctcaccatggtgcactactccaccgtc
accaaatgtcaggaggagcagggcagaatgtgcaaccaggtgtacaagagtcgctcctta
tccagacctcctcctctgccactgaagaagcaaaacacctcctctctgtggtccatcaat
gagcctttccacattcacctggtgcaaggcaaacgagtcaacgcagacgagggaatgaag
cttgtagtgcaggctggtctgttccatggcagcgagctgctctgtaaggtggtgacgagc
tcggaggtgacagtgagctccgagccgctgtggaatcagaagctggagtttgacataaac
gtggccgacctgccccgcatgagccgcctgtgtttcgcgctctacggcgtcattgaaaag
accaagaagccccgcggcaccaaaaagaagaacaagaaagcggattgtccaatagcctgg
gtgaacaccatggtgtttgactacaaggaccagctgaagactggggagttccacttatcc
acatggccgtgtgttcctgatgagaaaagtgacctgctgaacccgatgggaactgttgag
aagaaccctaatgtggacagcgccgctgaacttctcattcattttcccaacatccggcca
caccccctctactaccctccacttgaaaagatatgtgacatggagaggaatggtgatcta
agtttagccactaaagacgagtactttaagctcaaagaattcatggacaacaaaaactac
accgagtttttcgaggacgagaaagagctcctgtggaagctccgcaccgaagtccgcgat
cattatcctgaaagtctgtccaagctcctcctcatcaccaagtggaataagcgtgaggat
gtagttcagatggtgaatttactgaggaactggccagacctccctgccatccacgccttg
gagctcttagactacagttttcccgacccagcggttcgttctttcactatcagatgcctc
agaaagctcagtgatgatgagctgcttcattatctgatccagctggtccaggtcctgaag
tacgagtcctacctggactgtgaccttaccactttcttgttagaacgggcactgtccaac
aggaggatcggacattttctgttttggcatctcaggtcagagactcatgtggcatctgtg
ggtttgcgctttggcctgattctcgaggcctactgcaggggaaatatccatcacatcaag
ctcttaaccaaacagaatgaggctctgggcaaaatgaaggctctgagtgactttgtcaag
ttgggctcccagaaggtgacggcagaggacctgaagcagtgtatcagacaagagtcctac
ctggaggccctgtcagaccttctgtcaccactcaacccgagcatcatcctctctgagatc
tgtactgatagatgcagatttatggactccaagatgaagccactctggctgatgttcaag
aatcccgcagttgaaggagacatggtgggcattatcttcaaaaatggagatgaccttcga
caagacatgctgaccctgcagatgatccagctcatggagaatctgtggaagaaagaaggt
ctggatctcaggatgatcccgtacggctgcctgtcgaccgggaacaaaatggggctcatc
gaggttgtgaagaactctgacacaattgccaacatccagcgtaacagcagcaacagcgcc
gctaccgctgccttcaacaaggacgccttgcttaactggctcaaatcgaagaatcccgag
gacaaacttgatcaagcgatagaggagttcacactgtcctgcgctggctactgtgtagct
acttacgtcttgggcatcggagatcgtcacaatgacaacatcatgatcagggaaactgga
cagctgttccacattgattttgggcacttcctgggcaacttcaagcggaaactcgggatc
aacagggagcgcgtgccttttatcctgacgtatgactttgtccacgtgatccagcaagga
cgaacaaacaacagtgagaaatttgagaggttcagggagtactgtgagcgggcctataag
atcctgtgtcggaacgggacgctgtttgtcaacctcttcgccatgatgaaggcagcgggg
ctacctgaactcacgtccttcaaagacatacagtatctaaaggactctttagcgctgggc
aaaacagaggacgaggcgctgaagaacttcaaagtaaagttcaacgaagccttgcgggaa
agctggaagaccaaggtcaactggatgatgcactcactggccaaagataatagaccatga

DBGET integrated database retrieval system