KEGG   Maylandia zebra (zebra mbuna): 101469412Help
Entry
101469412         CDS       T02814                                 

Definition
(RefSeq) probable flavin-containing monoamine oxidase A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00260  Glycine, serine and threonine metabolism
mze00330  Arginine and proline metabolism
mze00340  Histidine metabolism
mze00350  Tyrosine metabolism
mze00360  Phenylalanine metabolism
mze00380  Tryptophan metabolism
mze00982  Drug metabolism - cytochrome P450
mze01100  Metabolic pathways
Module
mze_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101469412
   00330 Arginine and proline metabolism
    101469412
   00340 Histidine metabolism
    101469412
   00350 Tyrosine metabolism
    101469412
   00360 Phenylalanine metabolism
    101469412
   00380 Tryptophan metabolism
    101469412
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101469412
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101469412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 FAD_binding_2 DAO Pyr_redox_2 FAD_oxidored Lycopene_cycl HI0933_like GIDA FAD_binding_3 MCRA Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 101469412
NCBI-ProteinID: XP_004538473
Position
Un
AA seq 542 aa AA seqDB search
MTAEIWDVIVVGAGLSGLSAAHWLKKRDANMKILILEGKDRVGGRTVTAKLPAASGVDCW
DLGGQWVGSTQTHVLKLIKELGLEVYPQFNMGRKVHHMGGPTSKVRTYKTSIPALSPVVL
MDFTQILWKIDRLCATVCVQDPSKTPNAEELDSMTLHTYIEKHAWTAELKEEIGLCSRSV
FGIEPSQMSFLFFLMYATAAGGLLKLLESTPGCAQEFKIKGGTQQLSECLADRVGWKNVR
LGCAVTAIWQDAEWARVMTATDTFLCRAVIVTCPPHLAAKINYQPALPSQREFLTQNMPV
GHMIKFIITYKMAFWREKGFSGEIVAGSSTECPFCVTFDATSPFGNAALVGFIAGQQASH
WESKEVGERKNAVLSSLVKYLGPEAASFMHYEEKDWAKEDYSGGCPVNVMAPGLLTYYHP
SLRKPFGRIHWAGTETATQWCGYMDGAVQAGQRAALEVLAEVSHMTLTTEEQEELQRIQN
VKSASKQRPSSKLMYLPTSKSVVIATLTIGAVLLLAQHQNTVLKIKEYFTNAFSPIKHNL
LL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggaaatttgggacgttatagttgttggtgctggactttctggactgagtgca
gctcattggcttaaaaaaagggacgccaatatgaaaatactgattctggaagggaaagat
cgggtgggagggcgcacagtgactgccaagttaccagcagccagtggtgttgattgctgg
gaccttggagggcaatgggtaggaagtactcaaacgcacgtcttgaagctcataaaagag
ctgggcttagaagtctacccacagttcaatatgggtagaaaggtgcaccacatgggtggg
ccaacttccaaagttcgcacatacaagaccagcattcctgctctgtcccctgtggtgcta
atggacttcacccagatcctgtggaagattgacagactgtgcgcaacagtatgcgtccag
gatccctcaaagactccaaatgctgaagaactggacagcatgacgctgcacacgtacatt
gagaaacacgcttggactgcagaactaaaagaggaaatcgggctgtgtagcaggtctgtc
tttggaattgagccatcccagatgtctttcctattcttcctgatgtatgctacagctgct
ggagggctactgaagctgctggagagcactccaggttgtgctcaagagttcaagataaag
ggaggcacccaacagctttcagagtgtctggcagaccgtgttggatggaagaatgtccgg
ctgggttgtgctgtgacagccatatggcaggatgctgagtgggccagggtgatgactgct
acagacaccttcttgtgcagagctgtgattgtcacctgcccccctcatttggcagcaaag
atcaactaccaaccagccctgcccagccagagagaattccttactcagaacatgcctgtg
ggtcatatgataaaattcattattacctacaaaatggctttttggagggagaagggcttt
tctggggaaatagtggcagggtcctccaccgagtgtccattctgtgtaacctttgatgcc
accagcccttttggtaatgctgctctggtagggttcattgctggccagcaggcttctcat
tgggaatcaaaagaggttggagaaaggaaaaacgctgtgctttccagtctggtcaaatat
ctaggtcctgaggctgcatctttcatgcattatgaagaaaaagattgggccaaggaggac
tacagtggtggctgtccagttaatgtcatggcaccaggtttgctaacatattaccaccct
agcctgaggaagccttttggcaggatacattgggcaggaacagagacagccacccagtgg
tgtggatacatggacggagcggtgcaagctggtcagagagctgctctggaggtgctggct
gaagtgtcccacatgactctgaccacagaggagcaggaagaattgcagcgcattcaaaat
gtcaagagtgcttctaagcaaagaccatcatccaaactcatgtacctgcctacaagcaaa
tctgtggttatagcaacactgacaataggagccgttcttctgctggctcagcatcaaaat
acagtattaaagatcaaagagtacttcacaaatgccttttcaccaatcaagcacaacctt
ctgctgtga

DBGET integrated database retrieval system