KEGG   Maylandia zebra (zebra mbuna): 101469889Help
Entry
101469889         CDS       T02814                                 

Definition
protein O-mannosyl-transferase 1-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101469889
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     101469889
Glycosyltransferases [BR:mze01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101469889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 719 aa AA seqDB search
MLQLPLVVTAQVDLLLVLVSLLAFWTRLSHLNYPNAVVFDEVYYGQFVSLYMKRVFFIDD
SGPPLGHMILAFGAYLGGFDGNFVWNRIGAEYPSTVNVWSLRLLPALCGALCVPLVYLLT
LELKFSHLSALGAAVLLLLENSLIVQSRFMLLESVLIFFVLLAFFSYLRFHNAPSSSWSR
YSWLILSGVSCGAAVGVKYMGLFSYLLLLVVASLHTWKLIGDKTISHMNVCVQSVHRVLC
LVVVPVLLYVFWFYVHLSFLNRSGPHDQLMSSAFQASLQGGLSRITRGQPLEVAYGSQVT
LRSSVSQPIPCWLHSHKVNYPIRYDNGRGSSHQQQVTCYPFKDVNNWWIIKDPGRQQLVV
DTPPRPVRHGDVIQLVHGMTSRFLNSHDVAAPMSPHTQEVSGYIDFNVSMPAQNLWRVDI
SNREAESEVWKTILSEVRLIHVNTSAVLKLSGVSLPDWGFRQLEVVADKLFKAHSSSLEW
TVEEHRYGTSQEQKEREAELHSPTHIDVDRKISFWAKFVELQWKMLTVKQEESEHKYSSS
PLEWITMETNIAYWLHSSTNAQIHLIGNPVSWGVANLSLLAYQLLAVVYLLRRRRGLKDV
PDGVWDQFVCLGCVCVGGWLVNFVPFLLMDKTLFLYHYLPALCYLYLLSPALLEHAHTHL
LSSVTHQRALCVGALAVLLSIFLTYRTFCPLTYGSPELSAHQLQGLKWRDTWDILYRRR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgctacagctccccctggtggtgacagcccaggtagacctgcttctggtgctggtctcc
ttgctggccttctggaccaggctgagccatcttaattatcccaatgctgtggtgtttgat
gaggtgtattatggtcagtttgtgtctctctacatgaagagggttttcttcattgatgac
agcggaccacctctcggtcatatgatcctggcctttggagcgtacctgggaggttttgat
gggaactttgtgtggaacagaattggagcagagtatcctagcacggtgaatgtgtggagt
ctgaggcttctgccggccctttgtggagctctctgtgttcctctggtctacttgttgact
ttagagttgaagttctcccacctgtctgctctgggagctgcagtgctgttgctgctggag
aactctctgattgtccaatcacgtttcatgttacttgagtctgtcctcatcttcttcgtg
ctcctggctttcttctcatacctgcgcttccacaatgcacccagcagctcctggtccaga
tacagttggctgattctctctggtgtctcctgcggtgcggctgtaggggtgaagtacatg
ggtctgttctcatatctgctgctgctggtcgtggcttctctgcacacctggaagcttatt
ggagacaaaactatcagtcatatgaatgtgtgtgtgcaaagtgtacatagagttctgtgt
ctggtggtggttccagtcctgctctatgtgttctggttctacgttcacctgagtttcctg
aaccgcagcggaccacatgaccagctgatgagttctgctttccaggccagcctgcagggc
ggtctctccaggatcactcggggtcagcctctagaagtggcttatgggagtcaggtgact
ttgagaagctctgtctcccagccaattccctgctggctccattctcacaaagtcaactat
ccaatcaggtatgacaatgggcggggcagctctcaccagcagcaggtcacctgttatccc
ttcaaagatgtcaacaactggtggatcatcaaagatccgggcaggcagcagctggtggtc
gacactcctcctcgacctgtccgtcacggtgatgtcatccagctggttcatgggatgacg
tcacgttttcttaacagtcatgacgtagcagctccaatgagccctcacactcaggaagtc
tctggatacatagacttcaatgtgtctatgccggcacagaacctgtggagggtggacatt
tcaaacagggaggcagagtcagaggtgtggaagaccatcctatctgaagtccgactcatt
catgtcaacacttcagctgtcctcaagctgagtggtgtgtcccttccagactggggtttc
cgtcagttggaggttgtagcagacaaactgttcaaagctcacagcagcagtttggaatgg
acagtggaggagcaccgctatggaaccagtcaggagcagaaggaacgggaggcagagctt
cactctccaactcatatcgacgttgatagaaaaatttctttctgggcaaaatttgttgaa
ctgcaatggaagatgctgacagtaaaacaggaagagtcggagcacaaatacagttcctcc
ccattagagtggatcaccatggagaccaacattgcatactggctgcactcctccaccaat
gctcagatccatctaattggtaacccggtgtcatggggtgtggccaatctcagcctgctg
gcctatcagctgctggcagttgtctacttgttgaggaggaggcgaggcttgaaagatgta
cctgatggtgtgtgggaccagtttgtgtgtctgggatgtgtgtgcgttggcggctggttg
gtgaactttgttcccttcctgcttatggacaaaactcttttcctgtatcactacctgcca
gcactctgctacttgtacctactaagtccagctctgttggagcatgcacacactcacctg
ctcagcagcgtgacacatcagcgtgcattgtgtgtgggtgcattggctgtgttgctgtca
atcttcctgacctaccgcaccttctgtcccctaacctatggaagccctgaactgtcagcc
caccagctgcaaggactgaagtggagggacacctgggacatcctgtaccgacgtcggtag

DBGET integrated database retrieval system