KEGG   Maylandia zebra (zebra mbuna): 101470262Help
Entry
101470262         CDS       T02814                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mze00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mze00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mze04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 522 aa AA seqDB search
MALSSLSSVLWALLFVAAQVILSAGYNKCVARNFGYDSVVCECNSTYCDSIGSVSLPPLG
QFSSYLSNIAGSRLEASQGEVRANSTGERLRLTIVPYQKYQKTRGFGGAMTDAAAINILS
LSAGAQEQLLRQYFSSEGIGYSVVRVPMASCDFSTRLYTYADTPGDYDLHNFTLAPEDIN
MKIPLLQRAQALSPRPLSLLASAWSAPAWMKTNGALTGKGSLKGQPGGKEHKTWAQYYVR
FLEEYAKYNLTFWALTTGNEPSAGMMTNYSFQALGFTPEEQRDWVSLDLGPALHASSYPH
THILILDDSRILLPHWAKVVLSDIHAGRYIHGVAVHWYLDSVVPPDISLGTTHDLYPEYY
LFGTEACAGWNPLNKGVMLGSWDRAEQYAHDIIEDLNHYVVGWTDWNLALDPNGGPNWVK
NLVDSPVIVDATRDVFYKQPSFYSMAHFSKFLWEGSQRVGVSASGETHLEFSAFIRPDGS
LVLIILNRSSSDILFEVWDPPVGYIPSTAPAHSLLTLAWKRQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccctttcatctctgtcatctgtcctgtgggcgctccttttcgtggcagcacaagtg
atcctctctgcaggttacaataaatgtgttgccagaaactttggctatgactctgtggtg
tgtgaatgtaattcgacatattgtgacagcattggatctgtcagcctacctccactgggc
cagttctcgtcctacctgagcaacattgcgggcagcagactggaggccagtcagggtgaa
gttcgggctaacagcactggagaaaggctcaggttgactatcgttccctatcagaagtac
cagaagaccaggggatttggaggggcgatgacagatgcagcagccatcaatatactctct
ctttctgctggtgcacaggaacagctgctgaggcagtacttctccagtgaaggtattggc
tacagtgtagtgcgtgtccccatggccagctgtgacttctccacacgtctgtacacctat
gctgacacacctggagactatgatctgcacaatttcactctggccccagaagacatcaac
atgaagatccctctcttgcagcgtgcgcaggccttgtctcctcgtcctctgtctctgctg
gccagtgcctggagtgcccccgcctggatgaaaacgaacggtgcactcacaggaaagggc
tccctgaagggccagccagggggcaaggagcataaaacctgggctcagtactatgtcagg
ttcctggaggaatatgctaaatataacttgaccttctgggcactgacgacaggaaacgag
ccctctgcaggaatgatgacaaactacagttttcaagccctgggcttcactcctgaggag
cagagggactgggtgtctctggacctgggccctgccctgcacgcttcgtcatacccacac
acacacatcctcatactggatgacagccgcattctgctgccccactgggccaaagtggtc
ttaagtgatattcatgcaggaaggtacatccatggtgtggcagtccactggtacttagac
agcgttgtgccacctgacatcagcctgggaaccacccatgacctctacccggagtattac
ctgtttggcacagaggcctgcgctggttggaacccgctaaacaaaggagtgatgctggga
agctgggacagagctgaacagtatgcacatgacattatagaggacttgaatcattatgtg
gtcggctggactgattggaacctggcgctggacccgaacggtggaccaaactgggttaaa
aacttagtggacagccctgttatagtggatgcgacgcgtgatgtcttctacaagcagccg
tctttctacagcatggcccacttcagcaagtttctgtgggaggggtctcagagagtgggg
gtgtctgccagtggagagacacacctggaattttctgccttcatccgacctgatggctca
ctagtgctcatcatactcaacagatcatcatcagacatcctgtttgaagtctgggaccct
cctgtgggttacatcccctccactgctccagctcattctctgctcacacttgcttggaaa
aggcagtga

DBGET integrated database retrieval system