KEGG   Maylandia zebra (zebra mbuna): 101470262Help
Entry
101470262         CDS       T02814                                 

Gene name
gba
Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00511  Other glycan degradation
mze00600  Sphingolipid metabolism
mze01100  Metabolic pathways
mze04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101470262 (gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101470262 (gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101470262 (gba)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101470262 (gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 101470262
NCBI-ProteinID: XP_004541293
Position
LG11
AA seq 522 aa AA seqDB search
MALSSLSSVLWALLFVAAQVILSAGYNKCVARNFGYDSVVCECNSTYCDSIGSVSLPPLG
QFSSYLSNIAGSRLEASQGEVRANSTGERLRLTIVPYQKYQKTRGFGGAMTDAAAINILS
LSAGAQEQLLRQYFSSEGIGYSVVRVPMASCDFSTRLYTYADTPGDYDLHNFTLAPEDIN
MKIPLLQRAQALSPRPLSLLASAWSAPAWMKTNGALTGKGSLKGQPGGKEHKTWAQYYVR
FLEEYAKYNLTFWALTTGNEPSAGMMTNYSFQALGFTPEEQRDWVSLDLGPALHASSYPH
THILILDDSRILLPHWAKVVLSDIHAGRYIHGVAVHWYLDSVVPPDISLGTTHDLYPEYY
LFGTEACAGWNPLNKGVMLGSWDRAEQYAHDIIEDLNHYVVGWTDWNLALDPNGGPNWVK
NLVDSPVIVDATRDVFYKQPSFYSMAHFSKFLWEGSQRVGVSASGETHLEFSAFIRPDGS
LVLIILNRSSSDILFEVWDPPVGYIPSTAPAHSLLTLAWKRQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccctttcatctctgtcatctgtcctgtgggcgctccttttcgtggcagcacaagtg
atcctctctgcaggttacaataaatgtgttgccagaaactttggctatgactctgtggtg
tgtgaatgtaattcgacatattgtgacagcattggatctgtcagcctacctccactgggc
cagttctcgtcctacctgagcaacattgcgggcagcagactggaggccagtcagggtgaa
gttcgggctaacagcactggagaaaggctcaggttgactatcgttccctatcagaagtac
cagaagaccaggggatttggaggggcgatgacagatgcagcagccatcaatatactctct
ctctctgctggtgcacaggaacagctgctgaggcagtacttctccagtgaaggtattggc
tacagtgtagtgcgtgtccccatggccagctgtgacttctccacacgtctgtacacctat
gctgacacacctggagactatgatctgcacaatttcactctggccccagaagacatcaac
atgaagatccctctcttgcagcgtgcgcaggccttgtctcctcgtcctctgtctctgctg
gccagtgcctggagtgcccccgcctggatgaaaacgaacggtgcactcacaggaaagggc
tccctgaagggccagccagggggcaaggagcataaaacctgggctcagtactatgtcagg
ttcctggaggaatatgctaaatataacttgaccttctgggcactgacgacaggaaacgag
ccctctgcaggaatgatgacaaactacagttttcaagccctgggcttcactcctgaggag
cagagggactgggtgtctctggacctgggccctgccctgcacgcttcgtcatacccacac
acacacatcctcatactggatgacagccgcattctgctgccccactgggccaaagtggtc
ttaagtgatattcatgcaggaaggtacatccatggtgtggcagtccactggtacttagac
agcgttgtgccacctgacatcagcctgggaaccacccatgacctctacccggagtattac
ctgtttggcacagaggcctgcgctggttggaacccgctaaacaaaggagtgatgctggga
agctgggacagagctgaacagtatgcacatgacattatagaggacttgaatcattatgtg
gtcggctggactgattggaacctggcgctggacccaaacggtggaccaaactgggttaaa
aacttagtggacagccctgttatagtggatgcgacgcgtgatgtcttctacaagcagccg
tctttctacagcatggcccacttcagcaagtttctgtgggaggggtctcagagagtgggg
gtgtctgccagtggagagacacacctggaattttctgccttcatccgacctgatggctca
ctagtgctcatcatactcaacagatcatcatcagacatcctgtttgaagtctgggaccct
cctgtgggttacatcccctccactgctccagctcattctctgctcacacttgcttggaaa
aggcagtga

DBGET integrated database retrieval system