KEGG   Maylandia zebra (zebra mbuna): 101470334Help
Entry
101470334         CDS       T02814                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101470334
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101470334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 314 aa AA seqDB search
MTEKVFDIVVVGSCMTDLVSKAPRLPKAGETIHGHKFFIGFGGKGANQCIQAARLGVKTA
MVCKVGKDFFGDNYIQNFKDNGVHTEFVKQSSDAVTGAASITVDDAGENAIVIVAGANML
LGAEELQEALPAISHTKVLVCQLEISPQTSLQAMCMARDNKVKTIFNPAPAIPDLDPDFY
RVSDVFCCNESEAELLTGTSVASVEEAHRAGQKLLKRGCGSVIVTLGPQGCVVLKGGEPT
LKHVPAPEVTAVDTTGAGDSFIGALAFYMANHPHMPLEEMARRANLVAGVSVREIGTQTS
FPYRRDLPNEYFQE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaaggtctttgatattgtggtggttggctcctgtatgactgacttggtgagc
aaggcaccaaggctacccaaagcaggggaaaccatccatggtcacaagttcttcatcggt
tttggaggaaagggggccaaccagtgcatacaggctgccagacttggagtcaaaactgct
atggtctgcaaggttggaaaagacttctttggagacaattacatccagaatttcaaggac
aacggcgtccacacagaatttgtgaagcagagctctgatgcagtcacaggagctgcctcc
atcactgtcgacgatgcaggtgagaatgccattgtaattgtggccggtgccaacatgctg
ctgggtgcagaggagctacaggaagctctcccagccatcagccacacaaaagtcctggta
tgccagctggagatcagtccacagacgtccctgcaggcgatgtgcatggctcgcgacaac
aaagtgaagacaatattcaacccagcgccggccattcctgacttggatccagatttctac
agagtctccgacgtgttttgctgtaatgagtctgaggcagagctgctcaccggtacctcg
gtagccagtgtggaagaggcacatcgggctggtcaaaagctgttgaaacgaggctgcggg
tcagttattgtcaccttggggccccaagggtgcgtggtgctcaagggaggggagcctaca
ttaaaacatgttccagctcctgaggtcacagcagtggacacaacaggtgctggtgatagc
ttcattggagcactggcattttacatggccaaccacccacacatgcctctggaggagatg
gcccgcagagccaatctggtggcaggggtgagcgtgcgggaaatcggcacgcagacgtct
tttccgtacagacgggacctcccaaatgaatacttccaagagtag

DBGET integrated database retrieval system