KEGG   Maylandia zebra (zebra mbuna): 101470419Help
Entry
101470419         CDS       T02814                                 

Definition
(RefSeq) histone acetyltransferase KAT7-like
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101470419
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101470419
   HAT complexes
    HBO1 complex
     101470419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 631 aa AA seqDB search
MPRRKRTAGSSSDGTEDSDFSADVEHAEAAEIVHRRSSTRLTRASLRLSRSSQDNCSSPV
TVGSDEALDSAVESAPTAVAASVFSSGRRVTRSQQGAANTTAKKYPLRQSRSSGSDTEAH
VDIKQGADRDETPPRTPTGNAPSSESDIEVSSPSNDLVSSSNDIVVSQEEDERLAKELSL
KEAAAHDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGRHERHFSISGCPLYHNLSAD
ECKGKASTRDKQAEERTLSHRQDENRHSTRNQAPTERQLRYKEKVTELRRKRNTGLNKEQ
KEKYMEHRQSHGTSREPLLENITSDYDLELFRKAQARASDDLEKLRLAGQVSEGSNMIKT
IVFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIY
RKGNISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGY
FSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISY
RSYWKEVLLRYLNNFQGKEISIKEISQETAVNPVDIVSTLQSLQMLKYWKGKHLVLKRQD
LIDDWKAKETKRGNSKTIDPTALKWTPPKGT
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccccggagaaagaggaccgctggcagcagctcggacgggacggaggactcggacttc
tccgctgatgtcgagcatgctgaagctgctgagattgtgcacagacgcagcagcacacgc
ctgactcgcgcgtctctgcgactcagccgaagttcacaagataactgcagctctcctgta
actgtgggttctgatgaagctctggactcagccgtagagtcagcgccgacagctgttgca
gcatcagtcttctcctctgggcgcagggtcacacgcagccagcagggggcggcaaacacc
acagccaaaaaatacccactacggcagagcaggtcgtccggctctgacacagaggctcac
gtagacatcaaacaaggggcggatcgtgacgagacccctcctcgcacaccaacaggcaac
gccccgtcatcagagtcggacattgaagtttccagcccgagcaatgacctcgtgtcttct
agcaacgacattgtagtttcacaagaggaagacgagaggttagccaaagagctgtcgctc
aaagaggccgccgcccacgacctttcccaccggcccaaacgacggcgtttccacgagagc
tacaacttcaacatgaagtgtcccacacctggctgcaactcgctgggtcatctcacaggg
aggcacgagagacatttctccatatcaggatgccctctctaccacaacctttctgccgat
gaatgcaagggcaaggcatcgacacgcgacaaacaggccgaggaaaggacgctgtcgcac
cgtcaggacgagaacagacactccacgagaaaccaggcccctacagagcgtcagctgcgc
tacaaagagaaggtgacagagctgaggaggaagaggaacactggcctcaataaggagcag
aaggaaaagtacatggagcaccgtcagagccacggaacgagccgcgagcctctgctggag
aacatcaccagtgactatgacctcgagctgttcaggaaagcgcaggcacgtgcctcggac
gaccttgagaagctccgtctggctggccaggtgtcggagggcagcaacatgataaagacc
attgtgtttggacgttacgagctggacacctggtaccactctccatacccagaggagtac
gcccgcctggggaggctttacatgtgcgagttctgcctcaagtacatgaagagtcagacc
attctacgcaggcacatggccaagtgtgtgtggaaacaccctccaggtgacgagatttac
aggaaggggaacatctctgtctttgaggtggatggaaagaagaataagatttactgtcag
aatctgtgtctgctggcgaaactcttcctggaccacaagactctgtattatgatgtggaa
ccgttccttttctatgttatgactgaagctgacaacacagggtgccaccttgtcggatac
ttctccaaggagaaaaactccttcctgaactacaacgtatcctgcatcctcaccatgccg
cagtacatgaggcagggttacggcaagatgctcatagacttcagttacctgttgtccaaa
gtagaagagaaggtgggctcacctgagcggcccctgtcggacctgggactaatcagctac
cgaagttactggaaggaggtgctgctgcgctacctgaacaactttcagggcaaggagatt
tccatcaaagagatcagccaggaaactgcagtgaacccggtggatatagtcagcacactg
cagtccctccagatgcttaaatattggaaggggaagcacctggttttaaagagacaggac
cttattgatgactggaaggccaaggagaccaaacgtggtaacagcaagaccattgacccc
acagccttaaaatggaccccacccaaagggacgtag

DBGET integrated database retrieval system