KEGG   Maylandia zebra (zebra mbuna): 101470601Help
Entry
101470601         CDS       T02814                                 

Definition
neuroendocrine convertase 2-like
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101470601
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S8: subtilisin family
   101470601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 641 aa AA seqDB search
MLGSPRYGTALGFTVLLNALLLATQAAEGVLTDHFLVQLHEDAQDEAHQVATQHGFQSAR
KLPFGEGLFHLYPQDTSKRRSKRSARRRQQLQKDKRVKNVMEQEGFSRQKRGYRNINDIE
VNMSDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGEGVTIAIMDDGIDYLHPDLA
SNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGI
RMLDQPFMTDIIEASSISHMPQIIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRG
GKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNG
RKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK
RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKEWKTVPERFHCVAGSIQEVHK
IQSGNKLVLAITTEACQGKDNFVRYLEHVQTVVTVNASRRGDLNINMTSPMGTKSILLSR
RPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFQGDEPQRGVLKEWTLMLHGTQSAP
YIDQIVRDYQSKLAMSKKEELEEELDEAVERSLKSLLSKNN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcttggatcgccccgatatgggacagccttgggatttacagtgctgctgaacgcgctg
ctgcttgcgacgcaggctgcagaaggagtcttaacggaccattttctggttcagttgcat
gaggacgcacaggatgaagcgcaccaagttgcaacacaacatgggttccagagtgcccga
aagcttcccttcggagaagggctctttcacctctaccctcaggatacttcgaagaggcgg
agcaaacgcagtgcccgtaggagacagcagctccaaaaagacaaaagggtgaagaatgtc
atggaacaggagggattcagtcgtcagaagcgaggctacagaaatatcaacgatattgaa
gttaacatgagtgaccctctattcaccaagcagtggtatctgataaacacaggccaggca
gacgggacccctgggctggatcttaatgtggctgaagcttggcaactgggctacacaggc
gaaggagttaccatcgcaatcatggatgacggtattgactatctacatccagacctggca
tcaaattataatgccgatgccagctatgacttcagcagcaatgacccgttcccatttccg
cgctacacagatgactggtttaacagtcacggcacaagatgtgctggagaggtttctgcg
gcagccaacaacaacatctgtggtgtgggagtcgcctataactccaaggtggcaggtatc
agaatgctggaccagccatttatgactgacatcattgaggcatcatccatcagtcacatg
ccccagattattgacatctacagtgctagctggggaccaactgatgatggcaagacagtg
gatggacccagagagctcacattgcaggctatggcagacggcgtgaacaaggggcgcgga
gggaaaggcagcatctatgtctgggcctcaggagatggtggtagctatgatgactgtaac
tgcgatggttatgcctcaagtatgtggacaatctccatcaactctgccatcaacgatggg
cgcactgctctgtatgacgagagctgctcatccaccctggcatctacattcagtaatgga
cggaagaggaacccagaggctggagtggctactacagatctgtacgggaactgcacactg
cgtcactcgggaacctcagcagcagcgccagaggcagctggtgtctttgctctggctctt
gaggctaaccctaacctgacatggagagacatgcagcacctgtcagtcctaacttctaag
agaaaccagctccatgacgaagttcaccagtggcgaaggaatggcgtgggactcgagttc
aatcaccttttcggctatggcgtgctggatgctggtggcatggtgaaaatggcaaaggaa
tggaaaactgtgcctgagcgttttcattgtgtagctggatccattcaggaagtccataaa
atccagtctggtaacaagctggtgctggccataaccactgaagcctgtcagggaaaggac
aactttgtccgctacctggagcatgttcagactgtagtcactgtcaatgccagccgccgt
ggtgacctcaacatcaacatgacctcaccaatgggcacaaaatccatactgttgagccga
aggccccgtgatgatgactccaaggtgggctttgacaagtggcccttcatgaccacgcat
acctggggagaggacccccgtgggacctgggtccttgaggtgggctttcagggtgacgag
ccacagcgaggggtcctgaaggagtggactctcatgctgcacggaacacaaagtgcccct
tatatagaccagatagtacgtgattatcagtccaaactggccatgtccaaaaaggaggag
ctggaggaggagctggatgaggctgtagagagaagtctgaagagtttgctcagtaaaaac
aactag

DBGET integrated database retrieval system