KEGG   Maylandia zebra (zebra mbuna): 101472385Help
Entry
101472385         CDS       T02814                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101472385
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     101472385
Cytochrome P450 [BR:mze00199]
 Cytochrome P450, animal type
  CYP21 family
   101472385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 523 aa AA seqDB search
MEISIVSVGAAFLVVLLFMVLNWISGQKHKDVQENHKGRDDSRFLDQFLPCSSSLSLPGP
PGHFLIGNMMELKHDHLPIHLTNLAQRYGSIYRLKCGTTTMVVLNSSEVIREALVKKWCD
FAGRPISYTGNIVSGGGCNISLGDYTEKWKAQHRLVHSSLQRCCKKSLHDVIERQALHLL
KVLMGYKGCAVDLSEDFTVAASNVITTLAFGIEYDKSSSELQELHRCLNKIVALWGSAWI
SALDSFPLLRKLPNPVFAHLLKEVVRRDEIIGRHLNNYKQSQDKKNQDVITGSLLQGLDN
QNTEDKALLTDIHVHMATVDLLIGGTETTAAWLNWMVAFLLHRPEVQELVYEELCTVLEG
RYPKYSDRHRLPVLCSLISEVLRLRPVAPLAVPHRAIRDSSIAGYFIPKNTVIIPNLFGA
HHDPEVWPDPYSFKPERFLNEGGGSGGGSTRDLIPFGGGARLCLGESVAKMELFLFSAYL
LRDFQFLLPESETSLPDLRGVASVVLKIKSYEVVARPRPVTNP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatcaatagtcagtgtgggagctgcgttcctggttgtactgctgttcatggtg
ctgaattggatttctggtcagaaacacaaagatgttcaggaaaatcataagggaagagat
gattctagatttctggaccagtttcttccctgctcctcatctctttccctcccgggccct
cccggccactttctcattggtaatatgatggagctgaaacatgatcatctaccaattcac
ctcacaaatttggcacagcgctatggaagcatttatcgccttaaatgcggaacaacaact
atggtagtgctgaacagcagcgaagtcataagagaagcactggtgaagaaatggtgtgac
tttgccgggagaccgatctcatacacaggtaatattgtgtctgggggaggttgcaacata
tctttaggtgactatactgaaaagtggaaggcacaacatcgccttgtccatagttctctg
cagcgttgctgcaaaaagtctttgcatgatgtcattgagagacaagcgctgcatctgtta
aaggttttgatgggctataaaggctgtgctgtagatctgtcagaggattttactgtggcg
gccagtaatgtcatcaccactctggctttcggaatagaatatgataagagctcatcggag
ctgcaggagttgcacagatgtctcaataagattgttgctctgtggggctccgcttggata
tcagccctggactctttcccactgcttagaaaattacccaatcctgtttttgcccatctt
ctgaaagaggtggtcaggagagacgaaatcataggaagacatctcaacaattacaagcag
tcacaggacaaaaaaaatcaggatgtcatcacaggatccctcctccagggacttgacaat
cagaacacagaagacaaagcgctattaacagatattcatgttcacatggcaacagtggac
cttcttatcgggggaacagagactactgcggcctggctaaactggatggtggccttcctc
ctgcacagaccagaggtgcaggagttggtatatgaggagctgtgcacagtattggagggc
cgataccctaaatacagcgacagacacagacttccggtcctctgctctctgatcagtgag
gtgctcaggctcaggccagtcgcccctttggcagtaccacacagagccatcagagacagc
agcattgcaggttatttcatccctaagaacacagtcatcattcctaatctttttggagca
catcatgatcctgaagtttggcctgacccatacagcttcaaaccagagcgctttctgaat
gaaggagggggaagcggaggcggctccacccgtgacctgatcccttttggagggggggct
cggctctgcctgggagagtctgtggccaaaatggagctttttctgttcagtgcctacttg
ctgagagattttcagttcctcctgcctgagagcgagacctcactgcctgatctgagagga
gttgccagtgttgtgcttaaaatcaagtcctatgaagttgtagcacgtccaagacctgtg
actaatccctga

DBGET integrated database retrieval system