KEGG   Maylandia zebra (zebra mbuna): 101472881Help
Entry
101472881         CDS       T02814                                 

Gene name
tymp
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101472881 (tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101472881 (tymp)
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     101472881 (tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 430 aa AA seqDB search
MKDHGVDATSQTANIRPADMITIPDLIRKKRDGGQLSDDEIKAFIQAVKEKTIQDSQTGA
MLMAIWLNGMVSAEIKALTREMMSSGEVMEWPDEWKNFMVDKHSTGGVGDKVSLVLAPAL
VACGCKVPMISGRGLAHTGGTLDKLESIPGFKVEQSREQILEILDSVGCCIVGQTETLVP
ADRVLYALRDITSTVDSLPLVTGSIISKKGAESLFALVLDVKFGRAAICKDLESATELAQ
MLVEAGNGLGICTAAVLSGMNSTIGRCVGNSVEVIESLETLKGNGPDDLMELVTTQGGLL
LVMTGLVSDLSEGRKQISEAVVGGAALSKFQAMMEAQGVNSDTAQLLCSTNADYYSVLRK
AKHQLELKAPADGIVLEIDGLVLAQVLHRLGAGRSKAGEPVNHSVGAVLLVSIGQRVTKG
KRLLLLLLMV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccacggggtcgatgccacttcacagactgcaaacatcagaccagcagacatg
ataacaatcccagatctgatcaggaagaagagggatggaggacagttaagtgatgacgag
atcaaagccttcatccaggccgttaaagagaaaaccattcaggactctcagacaggggcc
atgctgatggctatttggctgaatgggatggtctccgccgagattaaggccctgacccga
gagatgatgtcatcgggagaagtgatggaatggcccgatgagtggaaaaatttcatggtg
gacaaacactcgactggcggggtgggagataaagtcagtctggtgttagcgccagcgcta
gttgcctgcggctgtaaggttcctatgatcagtgggcggggcttggctcatacaggagga
actcttgataaactggaatcaattccaggattcaaggtggagcaatcaagagagcagatc
ctggagatcctggactcagtgggctgttgcattgtgggtcagacagagactttggttcct
gcagatcgagtcctgtacgctctgcgggacatcaccagcaccgtggacagtttacctctg
gttactggttcgatcatctcaaagaaaggagccgagtctctgtttgctctggtgctggat
gtcaagtttggacgagctgctatctgcaaagacttggaaagtgctacagaactagctcag
atgctagtggaagcaggaaacggcctgggcatatgtacagcagctgtgctcagcggcatg
aacagtacgatcggtcgatgtgtgggaaacagcgtggaggtgatcgaatctctggagacg
ctgaagggaaacggacccgatgacctgatggagctggtcacgactcagggcggcttgttg
ctcgtgatgactggtctagtgtctgacctatcagaaggcagaaagcagatttccgaagct
gtggttggtggagcagcgctgtcaaagttccaggccatgatggaggctcagggcgtgaac
agcgacacagctcagctgttgtgctccaccaacgcagattactacagcgtcctgagaaaa
gcgaagcatcagctggaactgaaggctcctgcagacggtatcgttttggagattgacggt
ttggttttagctcaggtgcttcacagattgggtgcggggcgatcaaaggctggagagcct
gtcaatcacagtgtgggggcggtgctactggtgtctataggtcagagggtcacaaaaggt
aagaggctgttgctactgctgctgatggtgtga

DBGET integrated database retrieval system