KEGG   Maylandia zebra (zebra mbuna): 101473345Help
Entry
101473345         CDS       T02814                                 

Definition
polyprenol reductase-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101473345
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101473345
    1.3.1.94  polyprenol reductase
     101473345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 314 aa AA seqDB search
MWSSVGLSVINVVWSSLALCFLVAFCAHKVSRLLPGIFDTCPAYVLFQDLIRYGKTKQSL
KRDEWLRVFDVPKRWFWHFYAVSVGWNGLLLVLYLSFIFQHQSYPLWLSDFLDILTGAHS
SDSQVPQLSTVLVQLLLWVHSLRRLLECLFVSVFSDGAMHLVQYMFGLGYYIMLGLTILC
CDRMEKERSSLLSQLDWLLVAGFLLFIWASWLQHQSMVLLARLRTGKSGTVETLTHRVPK
GGWFELVSCPHYFAELLIYISLSFVFRGLSFTWWLVVLYVLFNQALAGQLCHDLYISKYK
SYPRHRRAFIPFVL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctcagtagggttgagtgtgattaacgttgtgtggtcttctctggctttgtgc
ttcctcgttgctttttgtgctcacaaagtgtcgcgactgttgccgggaatatttgacacg
tgtcccgcttacgttttatttcaggaccttattcgttacggaaaaactaaacagagctta
aagcgagacgaatggctgcgggtttttgacgtcccaaaaaggtggttctggcacttctat
gcagtctctgttggctggaatggtcttcttctggtcttgtacctcagctttatatttcag
catcagtcataccctttgtggttgagcgactttttagacattttgactggcgcacacagc
agtgacagtcaagtcccacagctttccaccgtcctggtgcagctgctgctgtgggtccac
tccctcaggaggctgctggagtgcctgtttgtcagcgttttctctgatggggcgatgcac
ttggtacaatatatgttcggcctggggtattacatcatgttagggttgacgatcctctgc
tgtgatcgtatggaaaaagagagaagctccctcctctctcagctggactggctgcttgtt
gctgggtttttactcttcatttgggcctcgtggctgcagcatcagtctatggtcctgctg
gccagacttcgcactggaaagtcaggaacagtggaaacgctgactcacagagtgccaaag
ggaggttggtttgagctggtttcttgtccccattactttgctgagctgctgatctacatc
tcgttgagctttgttttcagaggcctctctttcacctggtggcttgtggtactgtatgtg
ctcttcaaccaagcactggcaggacagctttgtcatgacctttacattagcaaatacaag
tcatacccaaggcatagaagagcatttataccctttgtgctatga

DBGET integrated database retrieval system