KEGG   Maylandia zebra (zebra mbuna): 101473637Help
Entry
101473637         CDS       T02814                                 

Definition
general transcription factor 3C polypeptide 4-like
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101473637
Transcription machinery [BR:mze03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     101473637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 770 aa AA seqDB search
MAAASTCDSVHTLPKNVVIKTEPEAEDVSVKREPVVPLIAPVSGLQPLSWSQDHRLAVCT
SSSLAVMELVCDVHNNKQDLTLHRTSIPVPAEEYKLRVGPSVELSEAMVKFATHPDPTVR
QAFLADSVINPSVGVHKGIKYASWSPLGCDSSGRCLLACLTLDHRLTIHNSHKRLEWNTL
VDLTKKYSERLKERNYARKDDKLPQTNLQDFDELQRRFRMQTPLRMEWSSIYTIKQVQPD
NTGVDLEMVLLAVLMENGDLVLWKFVLPFTDGADVTFYDTIESGVTRPSDLAWWEYENAD
RRMSGLIVGSEVGPVKIMPVSLSGVKGYFTLRHPVILWKECDEIAVENLKCVPMIHPIHK
SSCSLIVASRGCYVFWCLLVISPAGLNVHNSHVAGLHSLPVVSLAVSQQGVAVYTCSTDG
WIKKLTPTFTESTLIFKQEEMMRPENLTGRRIHGIAVSRNGAYIALVSTQGMVDGYHPVN
RTYQVHFVTLKTPEAAAALLLRSPTQNLYKMADLLDLVRWQILKNKSIPASLQDELDQKI
READSPYLWRFKLFLVRILHQSLQSPNTENNWKPAKEGSKVFIRDAEEEDGEDKEGAVKE
EGEPGGEKLEKEENQEEQRAEVQAWMNTVETHLMRENMKKVLGVVYLNTWLAENISIPTC
GLVEYLSKDTNDRASEVLIGHIKNKMNKQTFSERCSLCQDVLPFTDHKQTMCKNGHMWLR
CALSYQACQTLTFRRCLLLDSIARLPEPEDPEWIKKILQAPCTLCDSPMI
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccagtacctgtgattcggtgcacaccctgcccaaaaacgtagtcattaag
actgaaccagaagcggaggatgtgtcggtcaagcgggagcccgtcgttcctctcattgcc
ccggtcagcggactccagcctctctcgtggtcgcaggaccaccgcctggctgtgtgcacc
tccagttccctggcggtgatggagctggtgtgcgacgtccacaacaacaaacaggaccta
acgctgcacaggacttcaatccccgtcccagccgaggaatacaaactgcgggtggggcca
tcagtagagctgtctgaagcaatggtgaagttcgctacacatccagatcccacagtaagg
caagcatttttggctgacagcgtgatcaacccatcagtaggcgtgcacaaaggaataaag
tacgccagctggtctccgttgggttgtgactcgagtggacgctgcttgctcgcttgccta
acgcttgaccacagacttaccattcataacagccacaagcgtcttgagtggaacacgcta
gttgatcttactaaaaagtacagcgagaggctaaaagagcggaattatgccagaaaggat
gacaagctgccgcagactaacttacaggactttgacgagctgcagcggcgtttccgtatg
cagacgccactgagaatggagtggtcgagtatttacacgattaaacaggttcagccggac
aacacgggcgtagacttagagatggtcctcctcgctgtcttgatggaaaacggtgacctc
gtcttgtggaagtttgtgttgccttttacagacggggcagatgtcacgttttatgacacc
atcgaatcaggcgtgaccagaccaagtgacttagcgtggtgggagtatgaaaacgcagat
cgtcgcatgagcggcctgatcgtcggcagtgaggtgggacccgtcaagatcatgccagtc
agcctgtcgggagtgaaggggtacttcaccctccgacaccccgtcatcctgtggaaggag
tgcgatgaaatcgctgttgaaaacctcaaatgtgtcccgatgatccacccgatacataaa
tccagctgcagcctcatcgtcgcatcacgtggctgctacgtcttttggtgtttacttgtg
atttccccagctggactaaatgtacacaactctcacgtggctgggctgcactcccttcct
gtagtctccctggcggtcagtcaacaaggtgtcgcggtgtacacttgttccacagacggg
tggattaaaaagctgacgccaacttttacagagagcactttaatatttaagcaggaggaa
atgatgcgaccagagaacctcacggggaggaggatacacgggattgcagtgagccgcaac
ggagcatatattgcacttgtcagcacgcaaggtatggttgatggctatcatccagttaac
aggacttaccaggttcactttgtgaccttaaaaactccagaagccgcagcagcgttgttg
ctcaggtctcctacgcagaacttgtataaaatggccgacctgctcgacctggtgaggtgg
cagattttgaaaaacaagtccatccctgcatcactgcaggacgagctcgatcaaaagatc
cgggaagcggactctccttacttgtggcggttcaagctctttttggtgcgaatacttcac
cagtcactgcagtcacctaacacagaaaacaactggaaacctgcaaaagagggaagcaag
gtgttcataagagatgcggaagaggaggatggagaagacaaagaaggtgctgtgaaagag
gaaggtgagcccggaggagaaaaactggagaaggaggaaaatcaggaggagcaaagggca
gaggtacaggcttggatgaacaccgtagagactcacttgatgagagaaaacatgaagaag
gtgttaggggtggtgtacctcaatacctggctagcagagaacattagcatacccacctgt
ggcctggtggagtatctctctaaagacaccaacgacagagcatcagaggtcctgattggc
cacatcaagaataagatgaacaagcagacgttctcggagcgctgcagcctgtgtcaggat
gtgctgcccttcacagaccacaaacaaaccatgtgtaaaaatggacacatgtggctcagg
tgtgcgttgtcataccaggcctgccagacgctgacgttcagacggtgcctcctgctggat
agcatcgccagactgccagagcctgaggatccagagtggataaagaagatactgcaggca
ccctgcacgctctgcgactcgccgatgatctag

DBGET integrated database retrieval system