KEGG   Maylandia zebra (zebra mbuna): 101473712Help
Entry
101473712         CDS       T02814                                 

Definition
creatine kinase M-type-like
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mze00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MPFGNTHNNFKLNYKVEEEFPDLSKHNNHMAKVLTKEIYGKLRDKQTPSGYTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKDLLDPVISDRHGGYKPTDKHKTDLNHENLKGGDD
LDPNYVLSSRVRTGRSIKGFTLPPHNSRGERRIIERLSIEALNSLDGEFKGKYYPLNTMT
DAEQEQLIADHFLFDKPVSPLLTCAGMARDWPDGRGIWHNENKTFLVWVNEEDHLRVISM
QKGGNMREVFRRFCVGLQKIEEIFKKHDHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLS
KLSTHPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGESIDSMIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcggaaacacccacaacaacttcaagctcaactacaaagttgaggaggagttc
ccagatctgtccaagcacaacaaccatatggccaaggttctgaccaaggagatatatggc
aagctgagggacaaacagacacccagtggctacactctggatgatgtcatccagactggt
gtagacaaccctggtcaccccttcatcatgactgttggctgtgttgctggtgatgaggag
tcctatgaggtcttcaaggatctgcttgaccctgtcatctctgaccgtcatggtggatac
aagcccactgacaagcacaagactgacctcaaccatgagaacctgaagggtggtgacgac
ttggaccccaactacgttctgtctagccgtgttcgtactggtcgcagcatcaagggattc
accctgcccccccacaacagccgtggagagcgcagaattattgagaggctgtccattgag
gctctgaacagcctggatggtgagttcaagggaaagtactaccccctgaacaccatgact
gatgctgagcaggagcagctgatcgctgatcacttcctgtttgacaagcccgtgtctccc
ctgctgacctgcgctggtatggcccgtgactggcctgatggcagaggcatctggcacaac
gaaaacaagaccttcttggtctgggtgaatgaggaggatcaccttcgtgtcatctccatg
cagaagggtggcaacatgagggaggtgttcaggcgtttctgcgttggcctgcagaagatt
gaggagatcttcaagaagcacgaccatggcttcatgtggaatgagcatctcgggtacatc
ctgacctgcccctccaacctgggcactggcctgcgtggtggcgtccatgtcaaactgtcc
aagctgagcacacatcccaagtttgaggagatcctcaccaggctgcgtctgcagaagcgt
ggcacaggtggtgtggacactgcctctgtgggtggtgtgtttgacatctccaatgccgac
cgtctgggctcctctgaagtggagcaggtccaactggtggttgacggtgtcaagctgatg
gttgagatggagaagaagctggagaagggagagagcattgacagcatgatcccagcccag
aagtag

DBGET integrated database retrieval system