KEGG   Maylandia zebra (zebra mbuna): 101473754Help
Entry
101473754         CDS       T02814                                 

Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101473754
Peptidases [BR:mze01002]
 Cysteine Peptidases
  Family C86
   101473754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 183 aa AA seqDB search
MSEGEVFHEKQRLELCAIHALNNVLQERVFTKETADDICKRLAPQCVVNPHRSVLGTGNY
DVNVIMAALQSRELAAVWWDKRREVENLCMSKVQGFILNVPSRVSLGIVSLPLRRRHWLA
VRQVSGQYYNLDSKLKSPVCIGGEAELRTFLTEQLSQDVAEMLLVVRREVEEDGSWLNAD
SKK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggagaggtgtttcatgagaagcaacgattggagctgtgcgcaattcacgca
ctcaacaacgtgctccaggagcgggtgtttaccaaagagacagccgacgatatatgcaaa
aggctggctccacagtgtgttgtgaacccacatcggtcggtgttagggacgggaaactat
gatgtcaacgtcatcatggcggcactacagagccgggagttggctgcggtgtggtgggac
aaacgcagggaagttgagaacctctgtatgtcaaaggtccaaggctttattctgaatgtc
ccatcacgagtatctttggggattgtgtccctcccgctccggcggcggcattggctcgca
gttcggcaagttagcggacagtactacaacctggactctaagctgaagagtccggtctgc
atcggcggagaagcagagctgcgcacatttctcactgaacagctttctcaggacgtggca
gagatgctgctcgttgtccgacgggaggtggaggaggacggctcgtggctgaacgctgac
agcaagaagtga

DBGET integrated database retrieval system