KEGG   Maylandia zebra (zebra mbuna): 101473932Help
Entry
101473932         CDS       T02814                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101473932
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101473932
Transcription factors [BR:mze03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101473932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 864 aa AA seqDB search
MTSSIDQDDSSIFDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMD
KSTILQKSIDFLHKHKEIAAQSESTEIRQDWKPPFLSNEEFTQLMLEALDGFFLAIMADG
NIIYVSESVTSLLEHLPSDLVDQNLLNFLPVGEHSEVYKALSSHVMEGETLTPEYLKTKN
QLEFCCHMLRGTIDPKEPPVYEYVKFIGNFKSLNNVPNCTRNGFDGVIQRSLHSAFEDRV
CLIATVRLAKPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLETLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFI
VCTHTVVSYAEVRAEQRRELGIEESPPQITAEKQSQDSGSESQLNTFSLKEALERFDHSR
TPSASSRSSRKSSHTAVSDPASSQMKLQGDRSTPGRQSVSAVEMTSQRRSSISSQQSMSS
QNTGQNVASSMVSQQQPQQPQQQQQQQQQQQQQQVPTNNQSMVQFSSQLEAMQHLKEQLE
QRTRMIEVNIQRQQDELRQIQDELQRVQGQSLQMFLQKGPGGLNVSSVQMAQGNGGQQGG
TLSMQGQVVSAGSLQNSIQQQHAVQPPSQQQTLLREQNTALSQPQRSSHTVQPQQNPLPA
SLYNTMMIPQQSPANVVQIATSLAQNTGPNTPAVATFAQDRSAQIRFPAGPQLLTKLVTG
QMTCGAVMVPTTMFMGQVVTAFAPQQGQTQTISISQQAPQQQQQQEQQIQPQSQVTAMQQ
GQAPLTQQQTQFLQAPRLLHGNQSTQLILQAAFPLQQQGTFTAAAQQQQQQHQTQQKQLQ
QKQQQQLAPHRADSLSDRSATQPQ
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgagcattgaccaggatgacagtagtatttttgatgggttaatggaagaagat
gaaaaggacaaagcaaaacgcgtgtcccgtaacaagtctgagaagaagcgcagagaccag
ttcaatgtcctcatcaaggagttgggtacaatgctgccgggcaacacccggaagatggac
aagtccactattttgcagaaaagtatcgactttctgcacaaacacaaagaaatcgcagct
cagtcagagtcaactgagatcagacaagactggaaacctccttttcttagtaatgaagag
ttcactcagctgatgttggaggcgttagatggatttttccttgcaattatggctgatggg
aatataatctatgtctctgagagtgtgacttccctactagaacatttaccatctgatctt
gttgatcagaacttgttaaatttcttgcctgtgggggagcattcagaggtgtacaaggct
ctgtcctctcatgtcatggaaggagaaacattgacacctgagtatcttaaaacaaaaaat
cagctagagttctgttgccacatgctccgagggacaatcgaccccaaagagccccccgtg
tatgaatatgtaaagtttattggaaacttcaagtccctgaataatgtgcctaactgtacc
cgaaatggtttcgatggagtgatccagcgatcacttcactctgcctttgaagacagagtg
tgtctcatagccactgtgaggctagccaagccacagtttatcaaggagatgtgcacagta
gaagagcctaatgaggaatttacatccagacatagtttagagtggaaatttctcttcctg
gaccacagagctccgcccatcataggttacctcccatttgaggtcctgggtacatcagga
tatgactactatcatgtagatgaccttgagacactagccaagtgtcacgaacacttaatg
caatatgggaaaggaaagtcctgctactacagattcctcaccaaagggcagcaatggatt
tggcttcagacccattactacattacttatcaccagtggaactccaggccagagttcatt
gtctgcacacacacggtcgtaagttatgctgaagtaagagcagaacagcgcagagagctg
ggaattgaagaatcaccacctcaaatcaccgctgagaagcaatcccaggattcaggctct
gagtcccagctcaacactttcagcttgaaagaggccttagagcgatttgaccacagtcgg
accccatcggcctcgtctcgcagctcacgtaaatcttcccacacggctgtgtctgaccca
gcctcatcacaaatgaagcttcagggagataggagtacaccaggtcgccagtcggtctct
gctgtggagatgacatcacaacggagatcatctatcagcagtcagcagtcgatgagttcc
caaaatacaggacagaacgtggcgtcatccatggtttcacaacaacagccgcagcagcca
caacagcagcaacagcaacaacaacagcagcaacagcaacaagttccgaccaacaaccaa
tcaatggtccagttctccagccagttagaagccatgcagcacctgaaagagcagctggag
cagaggaccagaatgatcgaggtcaacattcagcggcagcaggatgagctgcggcagatc
caggacgagctacagagggtgcagggacagagtctgcagatgttcctgcagaaagggcct
ggaggactaaatgtgagctctgtacagatggcccaggggaatggtgggcagcaggggggt
acactcagcatgcagggccaggtggtttctgcaggatctctgcaaaacagcatacagcaa
caacatgctgtgcagcccccatcccagcagcaaacactcctacgggaacagaacacagca
ctctcgcagcctcagaggtcgtcgcacacagtgcagcctcaacagaatccactgcctgca
tctctctacaacacgatgatgatccctcagcaaagtcctgctaacgtggttcagattgcc
acaagcctggcgcagaatactggacccaacactcctgctgtggcaacatttgcacaggac
cgttcggctcagattaggtttcctgcaggcccccagctgctcaccaagctagtgacaggg
cagatgacatgtggggcagttatggtccccacaaccatgtttatgggtcaagtggtgacg
gcctttgcaccgcagcagggccagacgcagacaattagcatttcccaacaggctccgcag
cagcaacagcaacaggagcaacagattcaaccgcagtctcaggtcacagccatgcagcaa
gggcaagctccactgacccagcagcaaacacagttcctacaggctcctcgactccttcat
ggaaaccagtccacccagctgatcctgcaggcagcgttccctttgcagcagcagggtacc
ttcactgcagcagcccaacagcagcagcaacagcatcaaacacagcagaagcagttacaa
caaaagcagcaacagcagctggctcctcacagagcagatagtttgtctgaccgctcagcg
acacagccgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system