KEGG   Maylandia zebra (zebra mbuna): 101474181Help
Entry
101474181         CDS       T02814                                 

Gene name
pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101474181 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101474181 (pik3cg)
   04370 VEGF signaling pathway
    101474181 (pik3cg)
   04630 Jak-STAT signaling pathway
    101474181 (pik3cg)
   04068 FoxO signaling pathway
    101474181 (pik3cg)
   04070 Phosphatidylinositol signaling system
    101474181 (pik3cg)
   04150 mTOR signaling pathway
    101474181 (pik3cg)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101474181 (pik3cg)
  Cell growth and death
   04210 Apoptosis
    101474181 (pik3cg)
  Cellular commiunity
   04510 Focal adhesion
    101474181 (pik3cg)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101474181 (pik3cg)
  Endocrine system
   04910 Insulin signaling pathway
    101474181 (pik3cg)
   04914 Progesterone-mediated oocyte maturation
    101474181 (pik3cg)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101474181 (pik3cg)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101474181 (pik3cg)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101474181 (pik3cg)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101474181 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1122 aa AA seqDB search
MDRQQIQVSDEECQVPREESRRRRRKKAITSSCSTSMDQISVEFVLPTAARGGSGPDTLQ
LDVAGNWTVEQVKAQVWMKAVTSNLCPEFYQRFSPDHCILLYQKKGNVCEIYDKHQVFQT
LDCIRYWRALKKDVGRIQLVPRPQPSQESVEYQRYLNYLIGYDVTDVSNVHDDELEFTRR
KLLTPRRIELSERDPKLYSMDPWVTRKPLPEHLLSKINNGHILVVIHIGTASQTIKVSID
DTPTLVLASFFAKTSNKRALLGIPDNVCETDFVLRVCGREEYLYGEKPLENFNWIRQCLK
NGEEIHLVLEMPPDPDLDLVQKEDWAQVDDCTGVAGTHEQLTIDEKDHERVFTISMWDCN
RKFRVKVLGIDIPSLPKVPEFIVYIEASIFHGQQLLAQERTTSKTFSEEVLWNCWLEFNI
KIKDLPKGACLNLQVICGKQPQIPNSKGSSYQESTAGSSCLDGKTKSRLLYYVNLLLIDH
RSLLRQGEFILHMWKMPEKSEESSSSINADKLTSATNPDKASSMAIAILLDKYCYPVVLP
KSRDVGRDWAVGGEDAEGGERGQREMPNHLKKQFEAIVGTDPLHPLSPEDKELLWHFRHE
CMRDPRAYPKLLGSVRWGKQEDVLATHRLLERSSAWDTSGLDVGLAMQLLDCHYSDAQVR
SMAVRKLETLEDDDVLRYLLQLVQAVKFEPYHDSALVRFLLKRALRSKRIGHFLFWFLRS
EIAQSKHYQQRYAVLLEAYLRGCGENMLQDFRKQVDMTEALQKVTREIKTMSADKYDVTP
QVVFQLRQKLENLQSSGLPESFRVPYDPGLRAGALLIEQCKVMASKKKPLWLQFKRADST
TLSKDPIGIIFKDGDDLRQDMLILQILLIMESIWETESLDLCLLPYGCISTGNKIGMIEI
VKDATTIANIQQSVVGSTGAFKDEILYQWLRDKCVSEDKFQQAVERFLYSCGGYCVATYV
LGIGDRHNDNIMITESGNLFHIDFGHILGNYKSFMGISKEWVPFVLTPDFLYVMGTSGKK
SSPHFQKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIREALTVGRSE
DEAQRHLLDQIEICREKGWMVQINWFVHLVLGIKQGVEKRST
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcagcagatccaggtgagcgacgaagagtgtcaagtaccacgagaagagagc
cgaaggaggaggagaaagaaagccataacctcgtcctgctccacctccatggatcagatc
tctgtcgagtttgtgctgcccacagctgcgcggggtggaagtggccccgacactctgcag
ctggacgtggctgggaactggactgtcgaacaggtgaaagcccaggtatggatgaaggca
gtgacttcgaacctgtgccctgagttctaccagcgcttctctcctgaccattgcatcctg
ttgtaccagaagaagggcaacgtttgcgagatctatgacaagcaccaggtcttccagacg
ctagactgcattcgctactggagagctctgaagaaggatgtggggcggattcagctagtg
ccccgcccacagccctcacaggagtctgtggagtaccagcgctacctgaactacctgatt
ggctacgacgtaaccgacgtcagcaacgtccacgacgacgagctggagttcacacgcagg
aagctgctgaccccacgacgcatagagctgtcggaacgcgacccaaagctctactccatg
gacccctgggtgacacgcaagcctctgcccgagcacctgctctccaagatcaataatggc
cacattctggtggtaatccacatagggacagccagccagaccatcaaagtctccattgat
gacacaccaacactggtgttggcgagcttttttgccaagacatcaaataaaagagctttg
ctgggcatccccgacaatgtgtgtgagactgactttgtgctgcgggtgtgtggcagggag
gagtacctgtacggagaaaagcctctggagaactttaactggatccgtcagtgtctgaag
aatggcgaggaaatccacctggttctggagatgcctcctgatcccgatctggatctggtc
cagaaggaagactgggcccaagttgatgactgcactggagttgcaggcacccatgagcag
ctgaccattgatgagaaggaccatgaacgggtgttcaccatctccatgtgggactgtaac
aggaagttcagagtgaaggtgctgggtattgacatcccatctctccccaaagtcccggag
tttattgtctacatcgaggccagcatctttcacgggcagcagcttttagctcaggagaga
accacctctaaaaccttcagtgaagaagtgctgtggaactgctggctggagtttaacatt
aagatcaaggatctgcctaagggggcatgccttaacctccaggtgatctgtgggaagcaa
ccccagatcccaaattccaaaggaagctcttatcaagagagtacagcgggaagcagctgt
cttgatggaaagaccaagagtcgtctcctgtactacgtgaacctgctcctgatcgatcac
cgctccttgctccgccagggggagtttatcctccacatgtggaaaatgccagaaaagagc
gaggaaagcagcagtagcatcaacgcggacaagctcacctcagccacgaacccagacaag
gcctcttccatggccattgccattttgctggacaaatactgctaccctgtggtactaccc
aagagccgggatgtgggccgggactgggctgttgggggtgaggacgcagagggaggggag
cggggtcagagagagatgccaaaccacttgaaaaagcagtttgaggccattgtaggtacc
gatcccctacatcccctcagccctgaggacaaagagctgctgtggcactttagacacgaa
tgtatgcgtgaccccagagcctacccaaagctgctgggctcagtcagatgggggaaacag
gaagatgttttggcgacgcatcgactgctggagcgcagcagcgcatgggacaccagtggt
ctggatgttggcctggccatgcagctgcttgactgccactactcagatgcacaggttcgc
tcaatggctgtcaggaagctggagacgctggaggatgatgatgtgctccgatatcttctc
cagcttgtacaggcagtcaagtttgagccctaccatgacagcgctctagtcaggttcctg
ctgaagagagctctgaggagtaagcgtatcggtcattttctcttctggttcctgcggagt
gaaatcgctcagtccaagcactaccagcagaggtacgctgtcctcctggaggcctacctc
agaggctgtggtgaaaatatgctgcaggacttccggaagcaggtggatatgacagaggct
ctgcagaaagtcacccgtgagatcaagaccatgtctgcagacaagtatgatgttacgcca
caagtggtgtttcagttgcgtcagaagttggagaatctgcagtcctctggtctgccagag
agcttcagagttccttatgatccaggactaagagctggagccctgctgattgagcagtgc
aaagtgatggcgtctaagaagaagccgctgtggctgcagttcaaacgggccgattccacc
actctctccaaagaccccataggcatcatcttcaaagacggtgatgatctcagacaggat
atgctcatcctgcagattctgctgatcatggagtcgatctgggagactgaatcgctggat
ctctgtcttttaccgtacggctgcatctccactggaaataagataggcatgattgagatt
gttaaggacgccaccaccatcgccaacatccagcagagtgttgtgggaagcaccggcgca
tttaaagatgaaatcctctaccagtggctccgggacaagtgtgtcagtgaggacaagttc
cagcaggctgtggagaggttcctgtactcctgtggtggatactgtgtggctacatacgtc
ctgggtattggggatcgccataacgacaacatcatgatcactgaatctgggaatctcttc
cacatcgactttggtcacatcctggggaattacaagagtttcatgggaatcagtaaggag
tgggttccctttgtgctcacaccagacttcctgtatgttatgggaacttcgggaaagaaa
agtagcccccacttccagaagttccaggacgtgtgcgtgaaggcttacctcgcccttcgg
catcacaccaacctgctcatcattcttttctccatgatgcttatgactgggatgcctcag
ctgactagtaaggaggacatcgagtacatccgcgaggccctgactgttggccgcagtgaa
gatgaggcacagcgccacctgctggaccagatagagatctgcagggagaaaggctggatg
gttcagattaactggtttgttcatctggtcctgggaatcaagcagggtgtggagaaacgg
tccacttag

DBGET integrated database retrieval system