KEGG   Maylandia zebra (zebra mbuna): 101474202Help
Entry
101474202         CDS       T02814                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII, A1 polypeptide
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101474202 (f13a1)
Cell adhesion molecules and their ligands [BR:mze04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101474202 (f13a1)
   VLA-9
     101474202 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 728 aa AA seqDB search
MTGPTAETQKGRYAKPLPTSNLSYSDVVPEFEPFEGVAESEVTPRAFAPGGVLLEALKIN
MCQDVNKPKHYTTDYYMQNLVVRRGQEFVMQVTFNRPLAPEDDFHIEFTIGSDPSPNKGS
LVMVTFGNRGSSSWSGRILQSQGTSVMFGITPDAAAIVGKFQVYVAISTGMGMQRSKRDP
TTDLYLLFNAWCPDDHVFLPNEAERQEYVLNDEGVIYQGSSSSVVDRPWTFGQFERGILD
ACIFVLDASQMPIYDRGNVVKLVRVGSAMMNSQDDNGVMVGNWSNDYSMGKPPTSWTGST
KILLQYANTGVPVCFAQCWVYAGVFNTFLRCLGIPARVITNYNSAHDNTGNLKTDLLFNA
DGTPDRRNTRDSIWNYHCWNEVMIKRPDLPPGLEGWQVVDSTPQETSDGFFRCGPAPVIA
IKEGHVCYPFDCGFVFAEVNSDVVFLKRDKYGNLTPFRVDKTYVGEKILTKAVGSQQQNN
ITNTYKYPEGSAEDEATMARAEGFGCERDHSDVPEDDLSVTVIVEPCVIGQDVQLVATFK
NQGKVLRNVTAHLDCDIIFYTGVVASHFKDITFDVTVLPYQSYSVPFKIPAYEYQTQLSS
QTCLRFIVSGQSDNLHVLDLKVLELQTPDLKVTLNGEPLLNQEMGVKVEFTNNFGFPLRG
VNLSLEGAGLIGPKSKYYREIPPQATITWQETFIPWLPGLRRITALMDCQEVRQVSGFVE
VNIPYPAK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgactggtccaactgctgaaacccagaaggggcgctacgccaagccgctgccgacctcc
aacctgtcatattcagatgttgttccagaatttgaaccttttgaaggcgttgctgaatct
gaggtcacgcccagagcgtttgcacctggtggagtgttgctggaggcactgaaaatcaac
atgtgtcaggacgtcaacaagccgaagcactacaccaccgactactacatgcagaacctg
gtggtgcgccgtggtcaggagttcgtcatgcaggtgaccttcaaccgcccgctggctccg
gaggacgacttccacatcgagtttacgattggctccgatccttcgcccaataagggctcc
ctggtgatggtgaccttcggtaaccgtggcagcagttcgtggtcaggccggattctgcaa
tctcagggtacatctgtgatgttcggcatcacaccagatgccgccgccattgtggggaag
tttcaggtgtacgtggccatctccactggcatgggcatgcagcgctcaaagagggacccc
accactgacctgtacctgctcttcaacgcctggtgtccagacgatcacgtgtttcttcct
aatgaagcagaaagacaggagtacgtcctgaatgatgaaggggtgatctaccagggttca
tctagctctgtggtagaccgtccatggacatttgggcagtttgagcgcggcattttggac
gcctgtatcttcgtcctggatgcgtctcagatgccaatctacgaccggggcaacgttgtc
aagctggtcagggtgggatctgccatgatgaactctcaggatgataacggtgtgatggtt
gggaactggagcaatgactattccatgggcaaacccccgacgtcttggactggcagcacc
aaaatcctgctgcaatacgccaacaccggagtcccggtctgtttcgctcagtgctgggtg
tacgctggagtcttcaacaccttcctcagatgccttggcatcccagcaagggtcatcacc
aactacaattcagctcatgacaacacgggcaacctgaagactgacctcctcttcaatgct
gatggcaccccagacagacgcaacaccagggactccatctggaactaccactgctggaac
gaggtgatgattaagcgtcctgatttgccgcccgggctggaaggatggcaggtggttgac
tccacgcctcaggagaccagtgacggctttttccgctgtggtccagcaccggtcattgcc
attaaggagggtcacgtgtgttacccgtttgactgcggctttgtgttcgctgaggtgaac
agtgacgtggtcttcctgaagagagataagtacgggaatctgactcccttcagagtggac
aagacgtacgttggagagaaaattttaaccaaagctgtgggctcacaacaacagaacaac
atcacaaacacctacaagtaccctgaaggaagtgcagaagatgaggcgaccatggcccgg
gcggaggggttcggctgtgagagggatcacagtgatgtgcctgaggatgacctgtctgtc
accgtcatcgtggagccgtgtgttataggtcaggatgtgcagctggtagcgaccttcaag
aaccagggtaaagtcctcagaaacgtgacggctcacctggactgtgacatcatcttctac
actggagttgtggccagtcacttcaaagacatcaccttcgatgtgactgtgctgccctac
cagagttatagtgtgccgtttaagatcccagcttatgagtaccagacccagctgagctct
cagacctgcctgcgcttcattgtgagcggacagtctgataacctgcatgtgcttgactta
aaggtgctggagctgcagaccccggacctcaaagtgacgttgaacggggagcctctgctg
aaccaggagatgggtgtcaaagttgagttcaccaacaacttcggctttcctctgcgtggc
gtcaatctatccctcgagggagctgggctcataggtccaaagtctaaatactacagagag
attcctcctcaggctaccatcacctggcaggagacattcatcccttggctgcctggactg
cgtcggatcacggcgttgatggactgccaggaagtccgtcaggtgtctggatttgttgag
gtcaacatcccttaccctgcaaagtaa

DBGET integrated database retrieval system