KEGG   Maylandia zebra (zebra mbuna): 101474215Help
Entry
101474215         CDS       T02814                                 

Gene name
chka
Definition
(RefSeq) choline kinase alpha isoform X1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00564  Glycerophospholipid metabolism
mze01100  Metabolic pathways
Module
mze_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
mze_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101474215 (chka)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101474215 (chka)
    2.7.1.82  ethanolamine kinase
     101474215 (chka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo
Motif
Other DBs
NCBI-GeneID: 101474215
NCBI-ProteinID: XP_004575849
Position
LG7
AA seq 418 aa AA seqDB search
MKTKFINGVSSSPSMSLGLLVTENALQVQPDTQEDCDELVCSDQPDPDTRRRAYLWCREF
LHGAWKSLAEDLFQITIIRGGLSNKLFLCSLPDSLNCVGDEPRNVLLRLYGAILQMSCNK
GDSRESNKENHFQGAEAMVLESVMFAILAERELGPKLYGIFPQGRLEQYIPSRKLDTCEL
SDSSISAEVAQKMARFHGMRMPFNKQPKWLFGTMDKYLSQVMRLSFTREAHLRRFNRLLS
YNLPQEMEMLRSLLESTHSPVVFCHNDCQEGNILLLKGRQSSDKQKLMLIDFEYSSYNYR
GFDIGNHFCEWMYDYNCDEFPFFKVSAQNYPSKAQQLHFIESYLRESDRGFDGLSAEDQM
KLKEELYVEVNRFSLASHFFWGLWSIIQARLSTIKFGYLEYAQARFDAYFQQKKTWAV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattcatcaacggggtttcttcttccccctccatgtcgctgggcctgctg
gtgaccgagaacgccctgcaggtccagccagacacccaggaggactgtgacgagctggtc
tgctccgaccagcccgacccagacacccggaggagggcttatctgtggtgcagggagttc
ctgcacggagcctggaagagcctggccgaggacctgttccagatcaccatcatcaggggt
ggtctgagcaacaagctctttctgtgcagcctccccgacagcctgaactgtgttggggac
gagccgaggaacgtcctgctgcgcctctatggggccatcctgcagatgtcctgtaataaa
ggggattctcgagagtcaaacaaagaaaatcacttccaaggcgccgaggccatggtgctg
gagagcgtgatgttcgccatcttggctgagcgagagctcggacccaaactctacggtatt
ttccctcagggccgcctggagcagtacatccccagccgtaaactggacacctgtgagctg
agcgactccagcatctcggccgaggttgcgcagaagatggccaggtttcacgggatgagg
atgcccttcaacaagcaaccaaagtggctgtttggaaccatggacaagtacctgagccaa
gtgatgaggctgagcttcaccagagaggcgcacctgcgtcgcttcaaccgcctgctcagc
tataacctcccacaggagatggaaatgctcaggtctctgcttgagtccactcattctccc
gtggtcttctgccacaacgactgtcaggaaggaaacatcctgctgctgaaaggccgccag
agctcagacaaacagaagctgatgctcattgactttgaatacagcagctacaactacagg
ggattcgacatcggtaaccacttctgtgaatggatgtacgactacaactgcgatgagttt
cctttctttaaagtcagcgctcagaactacccttcaaaggcccagcagctccacttcatt
gagagctacctgcgcgagtccgatcgagggttcgacggcttgagcgcagaggaccaaatg
aagctgaaagaagagctgtacgtggaggtgaacaggttctcgctggcatctcacttcttt
tggggcttgtggtccatcatccaggcccggctgtccaccatcaaatttggatatctggag
tacgcacaggccaggtttgacgcctacttccagcagaagaagacctgggctgtgtaa

DBGET integrated database retrieval system