KEGG   Maylandia zebra (zebra mbuna): 101474276Help
Entry
101474276         CDS       T02814                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101474276
   01210 2-Oxocarboxylic acid metabolism
    101474276
   01230 Biosynthesis of amino acids
    101474276
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101474276
Enzymes [BR:mze01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101474276
Amino acid related enzymes [BR:mze01007]
 Aminotransferase (transaminase)
  Class I
   101474276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 511 aa AA seqDB search
MKSMSKITLQLQRCARDITNMSQQAVNGVSHRGRVLTLDSMNPNVKRVEYAVRGPIVQRA
VQIEKELKEGAKKPFTEVIKANIGDAHAMGQKPITFFRQVLALCSYPALLEDSKFPEDAK
QRARRVLEACGGHSIGAYSASQGIECIRQDVARYIEKRDGGIPSNPDNIYLSTGASDAIV
TILKLLVCGEGRDRTGVMISIPQYPLYSAALADLGAVQINYYLDEDNCWSLNITELRRAL
SAAREHCNPRVLCIINPGNPTGQVQSRQCIEDVIRFAKEEHLFLMADEVYQDNVYAEGCQ
FHSFKKVLFEMGPEYSNTVEMASFHSTSKCYMGECGFRGGYMEVINLDPEVKAQLIKLVS
VRLCPPVPGQALLDLVVNPPQPDEPSYATFMKERTAVLSALAEKARLTEQIFNTVPGITC
NPVQGAMYTFPRITLPQKAIDKAKELGLVPDMFYCMRLLDEEGICLVPGSGFGQREGTYH
FRMTILPPTEKLKVVLQKIREFQLRFTQEFS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccatgtccaagataacgcttcagcttcaacggtgcgctcgtgacataacaaac
atgtcccagcaggcagtgaacggggtctcgcaccggggcagggtgctgactttggacagc
atgaaccccaacgttaagcgggtggagtacgcggtccgcggacccatcgtccagcgggcg
gtgcagatagagaaggagctgaaggagggagcgaagaaacctttcacagaagtcatcaag
gccaacataggtgacgcccacgctatgggtcagaaaccaattacatttttcagacaggtc
ttggctctctgctcttatccagcactgttggaagatagcaagtttcctgaggatgccaag
caaagagcacggcgcgttcttgaggcctgcggaggccacagtataggggcctacagtgct
agccaggggatcgagtgcatccgtcaggatgtggcgcgctacatcgagaaaagagacggt
ggcatcccctccaaccccgacaacatctacctctccactggggccagcgatgccattgtg
accatattgaagttgctggtgtgtggggagggtcgtgaccgaacaggagtgatgatctcc
atcccccagtaccctctgtactcagctgccctggcagacctgggcgctgtccagataaat
tactacctggacgaagacaactgttggagtctgaacatcacagagctcaggagagcgctc
agtgccgcgagggagcactgcaatcctcgtgtcctctgcatcatcaaccccggaaacccc
actggtcaggtccagagcaggcagtgcatcgaagatgtgatccgatttgctaaagaggaa
catctcttcctcatggccgatgaagtctaccaggataatgtatacgcagagggctgccag
tttcactcttttaagaaagttctgtttgagatgggaccggagtactcaaacacagtggaa
atggcttcgttccactccacctccaaatgttacatgggagagtgtggattccgtggagga
tacatggaggtcatcaacttggaccctgaagtgaaagcccaactcataaaactagtgtct
gtgcgtctgtgtccaccagtccccggacaggccctactggatctcgtggtgaacccccca
cagcctgatgagccctcttatgccacttttatgaaggagcggacggcagtgctatcagct
ctggccgagaaggcccggctaacagagcagatcttcaacacagtgcctggtatcacctgt
aacccagtccagggagccatgtacaccttccctcgcatcactctacctcagaaggccatt
gacaaagccaaggagttgggcctggttccagacatgttctattgtatgaggctgttagat
gaggagggaatctgcctggtaccaggaagtggctttggtcagagagagggaacctaccac
ttcagaatgaccatcctgccgccaactgagaagctgaaggtggtactgcagaagatccgg
gagttccagttgcgcttcacacaagagttttcttaa

DBGET integrated database retrieval system