KEGG   Maylandia zebra (zebra mbuna): 101474285Help
Entry
101474285         CDS       T02814                                 

Definition
thymidine kinase 2, mitochondrial-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101474285
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101474285
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101474285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 271 aa AA seqDB search
MSVCVTLVSARRAVAPACLWAGWSGWRKACAGGFRLVPSRARSGTRPGAAGKLLRDGEDR
KAVICVEGNIASGKTTCLEYFSKTSSIEVLTEPISKWRDVRGHNPLALMYQDPQRWGITL
QTYVQLTMLDRHLSAVAAPVRMMERSLFSAKYIFVENLFRSGKMPEVDYAVLSEWFDWIT
ANICIPVDLIVYLQTSPQTCHERLKQRCREEEKVIPLEYLESIHQLYEEWLIRRSSWPVP
APVLVIPADHNLQRMLHQYEENRAKILAASL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgtgtgtcacactcgtgtccgctcgccgtgccgtggcgccggcatgtttgtgg
gctggatggagcgggtggaggaaagcgtgtgccgggggattcaggctggtcccgtccaga
gcccgcagcgggacacggcccggggctgcagggaagctgttgcgggatggagaggacagg
aaagcagtgatctgtgttgaggggaacattgccagtgggaagacaacatgtctggaatat
ttcagcaaaaccagcagtatcgaggtccttacagagccaatctctaaatggagagatgtc
cgagggcacaaccctctggctttaatgtaccaggatcctcagcgctggggcatcacgcta
cagacctacgttcagctcactatgctggatcgacacctgtcagctgtggcagctcctgtt
aggatgatggagagatctctcttcagcgccaagtacatctttgtggagaatctcttcaga
agtgggaaaatgccagaggtggactatgctgttctcagcgagtggtttgactggattaca
gctaacatttgcattcctgttgatctcattgtttacctgcagacgtctcctcagacctgc
catgaaaggttaaagcagcgatgcagagaagaggagaaagtcattccactggagtacctt
gagtccattcaccagctttatgaggagtggctaatcaggcgtagctcctggcctgttcct
gctcctgtgttggtgattcctgctgaccacaacctgcagaggatgctgcaccagtacgaa
gagaaccgagccaagatcctagcagcaagtctctga

DBGET integrated database retrieval system