KEGG   Maylandia zebra (zebra mbuna): 101474285Help
Entry
101474285         CDS       T02814                                 

Gene name
tk2
Definition
(RefSeq) thymidine kinase 2, mitochondrial isoform X1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00240  Pyrimidine metabolism
mze00983  Drug metabolism - other enzymes
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101474285 (tk2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101474285 (tk2)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101474285 (tk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin DUF1892 CoaE AAA_17
Motif
Other DBs
NCBI-GeneID: 101474285
NCBI-ProteinID: XP_004572105
Position
LG13
AA seq 271 aa AA seqDB search
MSVCVTLVSARRAVVPACLWAGWSGWRKACAGGFRLVPSRARSGTRPGAAGKLLRDGEDR
KAVICVEGNIASGKTTCLEYFSKTSSIEVLTEPISKWRDVRGHNPLALMYQDPQRWGITL
QTYVQLTMLDRHLSAVAAPVRMMERSLFSAKYIFVENLFRSGKMPEVDYAVLSEWFDWIT
ANICIPVDLIVYLQTSPQTCHERLKQRCREEEKVIPLEYLESIHQLYEEWLIRRSSWPVP
APVLVIPADHNLQRMLHQYEENRAKILAASL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgtgtgtcacactcgtgtccgctcgccgtgccgtggtgccggcatgtttgtgg
gctggatggagcgggtggaggaaagcgtgtgccgggggattcaggctggtcccgtccaga
gcccgcagcgggacacggcccggggctgcagggaagctgttgcgggatggagaggacagg
aaagcagtgatctgtgttgaggggaacattgccagtgggaagacaacatgtctggaatat
ttcagcaaaaccagcagtatcgaggtccttacagagccaatctctaaatggagagatgtc
cgagggcacaaccctctggctttaatgtaccaggatcctcagcgctggggcatcacgcta
cagacctacgttcagctcactatgctggatcgacacctgtcagctgtggcagctcctgtt
aggatgatggagagatctctcttcagcgccaagtacatctttgtggagaatctcttcaga
agtgggaaaatgccagaggtggactatgctgttctcagcgagtggtttgactggattaca
gctaacatttgcattcctgttgatctcattgtttacctgcagacgtctcctcagacctgc
catgaaaggttaaagcagcgatgcagagaagaggagaaagtcattccactggagtacctt
gagtccattcaccagctttatgaggagtggctaatcaggcgtagctcctggcctgttcct
gctcctgtgttggtgattcctgctgaccacaacctgcagaggatgctgcaccagtacgaa
gagaaccgagccaagatcctagcagcaagtctctga

DBGET integrated database retrieval system