KEGG   Maylandia zebra (zebra mbuna): 101474484Help
Entry
101474484         CDS       T02814                                 

Gene name
ncoa1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101474484 (ncoa1)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101474484 (ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1440 aa AA seqDB search
GDIASLSVKPEKCHILKSTVDQIQQIKRREQEKAALLSPDDEVQKSDISSSSQGLVEKEA
LGPMLLEALDGFFFVVNREGRIVFVSENVTSYLGYTQEELMASSVYSILHVGDHNEFVRN
LLPKSLVNGVPWPQEAGRRNSHAFNCRMLKRPPDEVDSENLEARQQYEIMQCFTVSQLRT
MQEEGDDLQSCLICIACRMPRTQPVSTESFITKQDPTGKIISIETSALRATGRPGWEDLV
RKCIYAFFQPQGKEPSHAKKLLHEVMTHGTAISPLYHFTLSDGTPLSAQTRCKFCCPPNP
DVQPFIMGIHTIDREHNTASSQENTNPSLPPTLSGIAQIPSRSPSLPPSSNSTQGSSLAT
AGLHTNNSNASSHGHNPATPTGYLTPNRTNCPQQVNSPSPLSSPLTATPTSFMSPRMPRA
SPGLGGSPRVPGNPFSPSTPGLHSPAGALSSGGSLNRQQSSGDGNSSASGGSTGSFSLSS
PVLQRQASTPTGSSIRPPSTKPSDGGEEGGEDSVKVPLSSASQLGNPRLNQLLDSNGTGA
DSNNNSNSIHCTSSPHPPNPAPAPQCPASHSSLTERHKILHRLLQDSSPNDASTTSEEGI
NKTEVEIKKEPPASPALGAGPPKSDSREPQDHQLLRFLLGTDEKDLDDLPPPSALSLQTV
RIKVEKKAGGEGVTCTGSTVGAGGATKLGGVSSPKSSPVGENRRDSRKDSRDSMISSVSV
DMDPLSQMLPGFRGPAGAKQGSEDTPNPGGGPQLQSPGPQPPATLQSPVPQLQSPLSQPQ
SLPQLQSPSPQLHSPSPQLKLQSPTQLQPGEASTPRNVNVKREPPGTPNRGLSDGRPPSG
CSLQSQSSFEFCNPATPSQQPGQGDPFQTPIDSSPFPEAEVMNPFTSTTGQTKMDAGDSQ
FQPLALADTLTFDGLGTPLQAPLASPQEQCVPCTLDEVLGPPTTPEARNDEKALLEQLVN
FLSGTDESELAELDKALGIDKLIQGGCFDPLPQNFPPQQPTATPVSIDPKLPTYPSQFTP
APQAPFPPELGTVGAQGLGFGAPRGAFPGGTGMGLRPGMTRPQGMGNPVRLPPNQLRLQL
QQRLQGPQQLQNRLAGMNQFPGGAQHVNMGIRQGVQQPQMPSQQPPLNAQMLAQRQRELY
SIQHRQRQLFQQKVMLMRQNIAGTPTGAVGPIGTARVPKAPPTTTQQQQQQQFNFPPGYN
LMAGNPPTSPSHFSPITAGPLDNKLPGRVPLNNQTLMGGVQGQFNSTVNSSLQQGLFQQF
GGSAVVQQDPPFAPEMSPSSPLLSPQNSTSQSPLLQQNSSTGYQSPDMKGWQPTSVGSLF
SQSGQSAGQPFGQQGVYNNMSITVSMAGGSSGVSSLPPIGQSVGMSNSNLSNVGSVCSDQ
QVQQVQVFADVQCTVNLVGSDSYLNQGSIGAAASQKGPGPQGSQNNQAQQKSLLQQLLTE
NT seq 4324 nt NT seq  +upstreamnt  +downstreamnt
gggcgacattgccagtctcagcgttaagcccgaaaagtgccacatcctcaagagcactgt
ggaccaaatccagcagatcaaacggcgtgagcaggaaaaagcagccctcctttctccaga
tgatgaggtgcagaagagcgacatctcctccagtagccagggactggtggagaaagaggc
gttggggcccatgctgctagaggcgcttgatgggtttttcttcgttgtcaaccgggaggg
gcgcatcgtctttgtttctgagaacgtgacgagttaccttggatacacccaggaggagct
catggcctccagcgtctacagcatcctccacgtgggagaccacaacgagtttgttcgtaa
tctgctgcctaaaagcctcgtaaatggtgtcccgtggccacaagaagctgggcgcaggaa
cagccacgcctttaactgtcgcatgctgaagagaccaccagacgaggtggattcggagaa
cctggaggcccggcagcagtatgagatcatgcagtgtttcaccgtgtcccagctacggac
catgcaggaggagggagatgacctgcagagctgcctgatatgcattgcctgccggatgcc
acgaacccagcctgtcagcacggagtcttttatcacaaagcaggatcccacagggaagat
catctccatagaaactagtgctttgcgagcgacaggcaggcctggatgggaggacctggt
caggaaatgtatctatgctttctttcagccgcagggcaaagagccctcccacgccaagaa
gcttttgcatgaggtgatgacacatgggaccgcaatcagcccgctgtaccatttcactct
gagtgatggcactccgcttagtgctcagacccgctgcaagttctgctgcccccccaaccc
tgatgtacagcccttcattatgggcattcacactattgacagggaacacaacactgctag
ctctcaggaaaacactaaccccagccttccaccaaccctcagcggtatcgcccaaattcc
ctcccgctccccttccctcccccccagcagtaattcaacccaaggctcaagtctcgccac
cgcgggccttcacaccaacaacagcaatgcctcttcccacggacataatccagccacgcc
gacaggctacctgacacccaatcggacgaattgtccccagcaggtcaacagcccctctcc
tttgagcagcccacttacagcaacccctacctcttttatgtcgcccaggatgccacgggc
cagtcctgggttaggtgggagccctcgggtaccagggaaccccttctctccctccacacc
tggcctccattccccagctggggctctaagcagtggaggaagcctcaacaggcagcagtc
tagtggtgatggcaacagtagcgcaagcggtgggtcaacagggtctttctccctgtcctc
tccggtccttcagagacaagccagtacacccaccggctcctctattcgacctccgtcaac
aaaaccctcagatggaggtgaagaagggggagaggactctgttaaagtccccctttcttc
tgcctcacagctgggtaaccccagactcaatcagctcctggatagcaatgggacaggagc
tgactctaacaacaacagcaacagcatccactgcacctcctcacctcatccacctaaccc
tgctcctgcccctcagtgccctgcctcccacagcagtctcactgaaagacacaagatcct
ccaccggctgcttcaggacagtagtcccaatgatgcctccaccaccagtgaggaaggaat
aaacaaaactgaagttgagatcaagaaggagccacctgccagtccggcgctgggtgcagg
acctcccaagagcgactcgagagagccacaggaccaccagttgcttcgttttctcctggg
tacagatgaaaaggacttggacgacctgccacctccatctgctctgagccttcagacagt
gagaattaaggtagagaagaaagctggtggggagggagtgacctgtacagggtcaacggt
tggcgcaggaggtgcaaccaaacttggaggagtgtccagccccaaatcgagccctgtcgg
agaaaaccgcagagacagccgcaaagacagccgagactccatgatttctagtgtatctgt
tgatatggaccctctctcccagatgctgcctggcttcagaggcccagctggggccaaaca
gggcagtgaggatacaccaaaccccggaggaggccctcaacttcagtctccgggtcccca
gcccccagctacgctccagtcccctgtgcctcagctccagtcacccctgtctcagcctca
gtccctcccacagttgcagtccccatcgcctcagcttcactccccttccccccagctcaa
actgcagtcacccactcagctccaacccggcgaggccagcactccccgcaatgtaaatgt
gaagagagagcctcctggcactcctaacagagggctcagtgatggcagaccgccctctgg
ctgcagccttcagagtcagtcttcatttgagttctgcaatcccgccactccaagccaaca
accgggacaaggagaccccttccagacccccatagacagcagtccatttccagaggccga
agttatgaaccctttcacctcaaccactggtcaaaccaagatggatgcgggtgattccca
gtttcagcctctggctctggctgacaccctgacatttgatggtctgggaactcctttgca
ggctcctttggcatcaccacaagagcagtgtgtgccctgtacgctggatgaagtgcttgg
ccctccaaccacacctgaagcccggaacgatgagaaggctctattagagcagctggttaa
cttcctcagtgggacagatgaaagcgaactggctgagcttgacaaagccctgggtatcga
caaactgatacagggtggctgctttgaccctttacctcaaaattttccaccccagcaacc
cactgccaccccagtttccatagaccctaaactccccacctacccttcccaattcacacc
agctccacaagctccttttcctccagagctgggcacggtgggggcgcagggtctggggtt
cggagcccctcgaggggccttccccggtgggacgggcatgggactgaggccaggcatgac
cagaccacaggggatgggcaatccggtcaggctgccaccgaaccaactgcgcctgcagct
gcagcagagactacaaggcccacagcagctccagaacaggctggcagggatgaatcagtt
tccaggaggagcccagcatgtgaacatggggattcgtcagggggtgcaacaacctcaaat
gccctcgcaacagcctccgctgaatgcccagatgctggctcagcgtcagcgggaactcta
cagcatccagcatcgccaacgccagctattccagcagaaggtcatgctgatgagacagaa
catagcaggcactcccactggagccgtggggcccattgggactgctagggtccccaaagc
tccccccacaacgactcaacaacagcagcaacagcagttcaacttcccaccagggtacaa
cctgatggcgggaaaccctcctacctcaccaagtcacttcagccccattaccgcgggccc
tctggacaacaagctgcccggcagagttcccctgaacaaccagacgttgatgggtggcgt
gcagggccagttcaacagcaccgtcaactcctcattgcagcaaggcctgtttcagcagtt
tggagggtccgctgtggtccagcaagacccaccgtttgctcctgagatgagcccctccag
cccacttttatcacctcagaactccacctcccagagtcctctacttcagcaaaactcatc
tactggctaccagtcacccgacatgaaaggctggcaaccaacaagcgtgggcagcctgtt
cagtcagtcaggacagagcgcagggcagccgtttggccagcagggggtttataacaacat
gagcatcaccgtttccatggccgggggctcgagtggcgtcagctcattacctcccattgg
gcagtcagttggcatgagcaacagtaacctcagcaacgttggttcagtgtgcagcgacca
gcaggtgcagcaggtccaggtatttgcggacgtccagtgcacagtgaaccttgttggcag
tgattcctacctgaaccagggctccatcggagctgcggcctcccagaagggccccggacc
ccagggctcccagaacaaccaagcccagcagaagagcctcctccagcagctgctcactga
gtga

DBGET integrated database retrieval system