KEGG   Maylandia zebra (zebra mbuna): 101475229Help
Entry
101475229         CDS       T02814                                 

Definition
UDP-glucuronosyltransferase 2B15-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101475229
   00053 Ascorbate and aldarate metabolism
    101475229
   00500 Starch and sucrose metabolism
    101475229
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101475229
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101475229
   00860 Porphyrin and chlorophyll metabolism
    101475229
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101475229
   00982 Drug metabolism - cytochrome P450
    101475229
   00983 Drug metabolism - other enzymes
    101475229
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101475229
Glycosyltransferases [BR:mze01003]
 Others
  Hydrophobic molecule
   101475229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MSGLSIPLFVTVLCFLLLSPPPCSSSNILVVPVDGSHWINMKLILEQLHSRGHNITVLRS
AKSWYIPNNSSIYTSINISTIVDETDINYYSKMLQDVMECRTYPTFIRTLCQQYLITPLF
DQVHKIWARSVATIIEDTVFIQKLQDTKFDLMLTDPAMTIGVLLATYLELPIVFNVRWIN
TGEGLFTIAPSPISYVPVPGSELHDQMDFLERIKNMLHYLYNVIEQHLIINPAYSDLLQR
HFPPGTDLLSLQRRADIWLFRADSVFEFPRPTIPNVVYIGGFHCKKAQPLPAKLEAFMQS
SGDHGVVFMSLGTFISALPRKVTEAIAAAFAELPHKVIWRFVGEKPSSLGNNTLLLEWLP
QSDLLGHPKTRAFVAHGGTNGLYEAIYHSVPVVGLPLLFDQFDNLLRLKVRGAARVLEAY
SLTKEDFLGALKDVLENPSFHTNMQHLSQLHRDKPMTPMDTAIFWIEYVIRNKGAPHLQS
AGFHLPWYSYFCLDVAALTIAITGIFIWALVFVCRLLCCRRSKRKMKPE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtctttccatccctctgtttgtgacagtgctctgcttcctgcttctcagcccc
cctccatgtagcagcagcaacattctggtagtccctgtcgatggtagccactggataaac
atgaaacttatccttgaacagttacactccaggggccacaacatcacagttctgcgctct
gcaaagagctggtacatccctaataactcttccatttatacttctattaatataagcacg
attgtggatgagacagacattaactactacagcaaaatgttacaagatgttatggaatgt
cgcacttatcctacatttatacgcacgctctgccaacagtacttgatcacacccttgttt
gatcaggttcacaagatctgggccagatcagttgctacaataatagaagacacagtattt
attcagaagctacaggataccaagtttgatttaatgttaactgaccctgctatgacaata
ggggtacttcttgcaacttacctcgagctgcctatagtttttaatgtgcgctggattaat
actggagaaggtcttttcaccatagctccctctcctatctcatatgtccctgtgccagga
agtgagctccatgatcagatggactttctggaaagaatcaaaaatatgctgcattatctt
tataatgtcattgaacagcacttgatcataaatcctgcctactcagacctgctccaacga
cacttccctccaggtactgatttgctgtctttacagcgtagagctgatatctggctgttc
agggcagattctgtctttgagttccctcggcccacaataccaaatgtagtatatataggg
ggcttccactgcaaaaaggcccagccactccccgctaagctggaagcattcatgcaaagc
tccggagatcacggggtggttttcatgtctctggggacatttatatcagccctacctcgg
aaggtcacagaggccatcgctgctgcttttgctgagctccctcacaaggtgatttggcgt
tttgtgggtgaaaaaccttcatctctcggaaacaacaccctgctgttggagtggctacct
cagagcgacctcctgggacaccccaagactcgtgcctttgtggcccatggaggcaccaat
ggcttgtatgaagccatctaccacagtgttcctgttgtgggcctccccctcctctttgac
cagtttgacaacttactccggctgaaggtgcgtggtgcagctcgggttttggaggcctac
tcactgaccaaagaagacttcctgggcgctctcaaggatgttcttgagaatccctctttc
cacactaacatgcagcatctgtcccagctacaccgtgacaaaccaatgactccaatggac
actgccatcttttggattgaatatgtcatcaggaacaaaggagcacctcacctacagtca
gcaggttttcatctgccttggtattcctacttctgtctggatgtggctgctttaaccata
gccataactggaattttcatctgggctttggtctttgtctgtaggctcctctgctgccgg
aggtcaaagagaaaaatgaaaccagagtaa

DBGET integrated database retrieval system