KEGG   Maylandia zebra (zebra mbuna): 101475256Help
Entry
101475256         CDS       T02814                                 

Definition
glutamate dehydrogenase 1, mitochondrial-like
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mze00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mze00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mze00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mze00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MYRYFGELLTRGAGGVLASGYPAAAADSVLPASASLLRHRGYSQAVDPADDPNFFTMVEG
FFDKGAAIVEDKLVEDLKTRETAEQKRSRVRGILRIIKPCNHVLSVSFPIKRDSGEWEVI
EGYRAQHSQHRTPCKGGIRYSTEVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKK
YSDNELEKITRRFTIELAKKGFIGPGIDVPAPDMSTGEREMSWIADTFATVMGHNDINAH
ACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSQLGMYPGFQDKTFVIQGFGNV
GLHSMRYLHRFGARCVGVGELDGSIWNPEGINPKELEDYKLANGTIVGFPDSTPYEGSIL
EADCDILIPAASEKQLTKSNAHKIKAKIIAEGANGPTTPEADQIFLERNILVIPDMYLNA
GGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGSVPVVPTSE
FQARIAGASEKDIVHSGLAYTMERSARVSTPNLQRRTKGKSYNVTATSL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggtacttcggagagctactcacccggggagcgggcggcgtcctggcctcgggg
taccccgccgccgctgctgactctgttctgccggcgtccgcgtccctgctgcggcaccgc
ggctacagccaggccgtagatccggccgacgacccgaacttcttcactatggtagagggc
ttcttcgataagggcgccgctatcgtggaggacaagctggtggaagacctgaagactcga
gagactgccgagcagaagaggagccgggtccgcgggatcctgcggatcatcaagccgtgc
aaccacgtcctgagcgtcagcttccccatcaagagagacagcggggagtgggaggtgatc
gagggctaccgggctcagcacagccagcaccggacgccctgcaagggaggtatccgttac
agcacagaggtgtctgtggacgaggtgaaagctctggcctcgctgatgacctacaaatgt
gctgtcgtagatgtgccttttggtggagccaaagccggcgtgaagatcaacccgaagaag
tactcggacaacgagctggagaagataacccgaaggtttaccatcgagctcgccaagaag
ggcttcatcgggcccggcatcgacgttcctgctccggatatgagcaccggggagcgcgag
atgtcctggatcgccgacaccttcgccaccgtcatgggacacaatgacatcaacgcccac
gcctgcgtcaccgggaagcccatcagtcagggaggaattcacggccgcatctccgccacc
ggccggggagtcttccacggcatcgagaacttcatcaacgaggcgtcatacatgagccag
ctcgggatgtaccccgggttccaggacaagaccttcgtcatccagggcttcggtaacgtg
gggcttcacagcatgcgctaccttcaccgctttggagcgaggtgcgtcggagtcggagaa
ttggacggaagcatctggaaccccgaaggcatcaaccccaaagagctggaggactacaaa
ctggccaacgggaccatcgtgggtttcccggactcgacgccatacgaaggaagcatcctc
gaggccgactgcgacatcctgatccccgccgccagtgagaaacagctgaccaaaagcaac
gcccacaagatcaaggccaagatcatcgcagagggagccaacgggccgactacacctgaa
gctgaccagatcttcctggagagaaacatcctggtgatcccggacatgtacctgaacgct
ggcggtgtgacggtttcctacttcgagtggttgaagaacctgaaccacgtcagttacggg
cgactcaccttcaaatacgagcgagactccaactatcacctgctgatgtcggtccaggag
agtctggagaggaagttcggcaaacacggcggctccgtccccgtcgtccccacctctgag
ttccaggctcggatcgccggagcgtctgagaaggacatcgttcactcgggtctggcctac
accatggagcgctctgcccgggtaagcacgccaaacctgcagcgccgcacgaagggaaag
tcatacaacgtcaccgcgaccagtttatga

DBGET integrated database retrieval system