KEGG   Maylandia zebra (zebra mbuna): 101475256Help
Entry
101475256         CDS       T02814                                 

Gene name
glud1
Definition
(RefSeq) glutamate dehydrogenase 1
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101475256 (glud1)
  Energy metabolism
   00910 Nitrogen metabolism
    101475256 (glud1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101475256 (glud1)
   00220 Arginine biosynthesis
    101475256 (glud1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101475256 (glud1)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101475256 (glud1)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101475256 (glud1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 546 aa AA seqDB search
MYRYFGELLTRGAGGVLASGYPAAAADSVLPASASLLRHRGYSQAVDPADDPNFFTMVEG
FFDKGAAIVEDKLVEDLKTRETAEQKRSRVRGILRIIKPCNHVLSVSFPIKRDSGEWEVI
EGYRAQHSQHRTPCKGGIRYSTEVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKK
YSDNELEKITRRFTIELAKKGFIGPGIDVPAPDMSTGEREMSWIADTFATVMGHNDINAH
ACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSQLGMYPGFQDKTFVIQGFGNV
GLHSMRYLHRFGARCVGVGELDGSIWNPEGINPKELEDYKLANGTIVGFPDSTPYEGSIL
EADCDILIPAASEKQLTKSNAHKIKAKIIAEGANGPTTPEADQIFLERNILVIPDMYLNA
GGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGSVPVVPTSE
FQARIAGASEKDIVHSGLAYTMERSARQIMRTANKYDLGLDLRTAAYVNAIEKVFKVYSE
AGLIIT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggtacttcggagagctactcacccggggagcgggcggcgtcctggcctcgggg
taccccgccgccgctgctgactctgttctgccggcgtccgcgtccctgctgcggcaccgc
ggctacagccaggccgtagatccggccgacgacccgaacttcttcactatggtagagggc
ttcttcgataagggcgccgctatcgtggaggacaagctggtggaagacctgaagactcga
gagactgccgagcagaagaggagccgggtccgcgggatcctgcggatcatcaagccgtgc
aaccacgtcctgagcgtcagcttccccatcaagagagacagcggggagtgggaggtgatc
gagggctaccgggctcagcacagccagcaccggacgccctgcaagggaggtatccgttac
agcacagaggtgtctgtggacgaggtgaaagctctggcctcgctgatgacctacaaatgt
gctgtcgtagatgtgccttttggtggagccaaagccggcgtgaagatcaacccgaagaag
tactcggacaacgagctggagaagataacccgaaggtttaccatcgagctcgccaagaag
ggcttcatcgggcccggcatcgacgttcctgctccggatatgagcaccggggagcgcgag
atgtcctggatcgccgacaccttcgccaccgtcatgggacacaatgacatcaacgcccac
gcctgcgtcaccgggaagcccatcagtcagggaggaattcacggccgcatctccgccacc
ggccggggagtcttccacggcatcgagaacttcatcaacgaggcgtcatacatgagccag
ctcgggatgtaccccgggttccaggacaagaccttcgtcatccagggcttcggtaacgtg
gggcttcacagcatgcgctaccttcaccgctttggagcgaggtgcgtcggagtcggagaa
ttggacggaagcatctggaaccccgaaggcatcaaccccaaagagctggaggactacaaa
ctggccaacgggaccatcgtgggtttcccggactcgacgccatacgaaggaagcatcctc
gaggccgactgcgacatcctgatccccgccgccagtgagaaacagctgaccaaaagcaac
gcccacaagatcaaggccaagatcatcgcagagggagccaacgggccgactacacctgaa
gctgaccagatcttcctggagagaaacatcctggtgatcccggacatgtacctgaacgct
ggcggtgtgacggtttcctacttcgagtggttgaagaacctgaaccacgtcagttacggg
cgactcaccttcaaatacgagcgagactccaactatcacctgctgatgtcggtccaggag
agtctggagaggaagttcggcaaacacggcggctccgtccccgtcgtccccacctctgag
ttccaggctcggatcgccggagcgtctgagaaggacatcgttcactcgggtctggcctac
accatggagcgctctgcccggcaaatcatgagaaccgccaacaagtacgacctgggtttg
gacctgcggacggcggcgtacgtcaacgccatcgagaaggtgttcaaggtttacagcgag
gccggcctcatcatcacatag

DBGET integrated database retrieval system