KEGG   Maylandia zebra (zebra mbuna): 101475256Help
Entry
101475256         CDS       T02814                                 

Definition
(RefSeq) glutamate dehydrogenase 1, mitochondrial-like
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101475256
  Energy metabolism
   00910 Nitrogen metabolism
    101475256
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101475256
   00220 Arginine biosynthesis
    101475256
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101475256
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101475256
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101475256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MYRYFGELLTRGAGGVLASGYPAAAADSVLPASASLLRHRGYSQAVDPADDPNFFTMVEG
FFDKGAAIVEDKLVEDLKTRETAEQKRSRVRGILRIIKPCNHVLSVSFPIKRDSGEWEVI
EGYRAQHSQHRTPCKGGIRYSTEVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKK
YSDNELEKITRRFTIELAKKGFIGPGIDVPAPDMSTGEREMSWIADTFATVMGHNDINAH
ACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSQLGMYPGFQDKTFVIQGFGNV
GLHSMRYLHRFGARCVGVGELDGSIWNPEGINPKELEDYKLANGTIVGFPDSTPYEGSIL
EADCDILIPAASEKQLTKSNAHKIKAKIIAEGANGPTTPEADQIFLERNILVIPDMYLNA
GGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGSVPVVPTSE
FQARIAGASEKDIVHSGLAYTMERSARVSTPNLQRRTKGKSYNVTATSL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggtacttcggagagctactcacccggggagcgggcggcgtcctggcctcgggg
taccccgccgccgctgctgactctgttctgccggcgtccgcgtccctgctgcggcaccgc
ggctacagccaggccgtagatccggccgacgacccgaacttcttcactatggtagagggc
ttcttcgataagggcgccgctatcgtggaggacaagctggtggaagacctgaagactcga
gagactgccgagcagaagaggagccgggtccgcgggatcctgcggatcatcaagccgtgc
aaccacgtcctgagcgtcagcttccccatcaagagagacagcggggagtgggaggtgatc
gagggctaccgggctcagcacagccagcaccggacgccctgcaagggaggtatccgttac
agcacagaggtgtctgtggacgaggtgaaagctctggcctcgctgatgacctacaaatgt
gctgtcgtagatgtgccttttggtggagccaaagccggcgtgaagatcaacccgaagaag
tactcggacaacgagctggagaagataacccgaaggtttaccatcgagctcgccaagaag
ggcttcatcgggcccggcatcgacgttcctgctccggatatgagcaccggggagcgcgag
atgtcctggatcgccgacaccttcgccaccgtcatgggacacaatgacatcaacgcccac
gcctgcgtcaccgggaagcccatcagtcagggaggaattcacggccgcatctccgccacc
ggccggggagtcttccacggcatcgagaacttcatcaacgaggcgtcatacatgagccag
ctcgggatgtaccccgggttccaggacaagaccttcgtcatccagggcttcggtaacgtg
gggcttcacagcatgcgctaccttcaccgctttggagcgaggtgcgtcggagtcggagaa
ttggacggaagcatctggaaccccgaaggcatcaaccccaaagagctggaggactacaaa
ctggccaacgggaccatcgtgggtttcccggactcgacgccatacgaaggaagcatcctc
gaggccgactgcgacatcctgatccccgccgccagtgagaaacagctgaccaaaagcaac
gcccacaagatcaaggccaagatcatcgcagagggagccaacgggccgactacacctgaa
gctgaccagatcttcctggagagaaacatcctggtgatcccggacatgtacctgaacgct
ggcggtgtgacggtttcctacttcgagtggttgaagaacctgaaccacgtcagttacggg
cgactcaccttcaaatacgagcgagactccaactatcacctgctgatgtcggtccaggag
agtctggagaggaagttcggcaaacacggcggctccgtccccgtcgtccccacctctgag
ttccaggctcggatcgccggagcgtctgagaaggacatcgttcactcgggtctggcctac
accatggagcgctctgcccgggtaagcacgccaaacctgcagcgccgcacgaagggaaag
tcatacaacgtcaccgcgaccagtttatga

DBGET integrated database retrieval system