KEGG   Maylandia zebra (zebra mbuna): 101475598Help
Entry
101475598         CDS       T02814                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1-like
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101475598
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101475598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 265 aa AA seqDB search
MDALLSLLFSSEEEELYMLDRMAYFMFLMAACTFITLLFENVPYGRYATSKYGFPVNARF
AWFVQELPALLLPMCLLLWTSSSKTSLLPNQLLIAMYFLHYVQRACIYPFLIRGGKPTPF
ASFALAFVFCCYNGFMQIRYLSHYAEYPAYWVTHPCFLIGSVLWFVGWFINVQSDHILRN
LRKPGETGYKVPKGGMFEYVSGANFLGEITEWAGFTLAGHSVHSAAFAIFTAVVLASRAV
AHHKWYLAKFEDYPKSRKVLIPFLF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctcctctccctgctcttctcctcagaggaagaggagctgtacatgttggac
cgcatggcttacttcatgtttttaatggcagcctgcacttttattactttgctgtttgaa
aatgttccttacgggcggtatgctacaagcaagtatggatttccagttaacgccaggttc
gcctggttcgtccaggagctgccagccttactgctccctatgtgtctgctactctggaca
tcttcttccaagacgtctttactacctaatcagctcctcattgccatgtatttccttcac
tatgtccagagagcctgcatttatccatttttaatcagaggagggaaaccgacaccgttc
gcttcattcgctctggcctttgtgttctgctgctataatggtttcatgcagatcaggtac
ctgagccattatgctgagtacccagcatactgggttacacatccatgcttcctcattggc
tcggtactgtggttcgtcggctggtttataaatgtacaatctgaccacatccttaggaac
ctgagaaagcccggagagactggttacaaggttcccaaaggcggcatgttcgagtacgtg
tctggggccaacttcttgggcgagataacagagtgggctggcttcactctggctggtcac
tctgttcacagtgcagccttcgccatctttaccgcagtggtcctcgctagcagagctgtg
gcccaccacaaatggtaccttgccaagtttgaggactaccctaaaagcaggaaggtgttg
attccctttctgttctag

DBGET integrated database retrieval system