KEGG   Maylandia zebra (zebra mbuna): 101475820Help
Entry
101475820         CDS       T02814                                 

Definition
protein-arginine deiminase type-2-like
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101475820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 700 aa AA seqDB search
MFQDVYQTNVPPHIPTFLNKKRKVTTGSQLTCRLDTQKTQQLLYVVGTSLTAKVNRSAPP
TSKFFSVKGTANVQYSISPTPRDTSHLSPIPLTENSVLLISRDHASQHENDSKLSVQYYG
ANKEVLGRAVVHLTAVELSLDVDADRDGIVEKNNPKKGSWKWGPNGHGAILLVNCDSEKT
YKKTPDSEDKSIYKVSDLKDMSVMVLRTKGPGKLPEGYKLTMHISQGDAESVRVFRNRST
EVSNSGLSQKLYNLFVKDYPLVLSSDVLSKEVPYLGGVAEMNFYVEGLRFPDKDFNGLVT
INLSLLEPISDGLPETPIFTDKVVFKVAPWIMTPNTLRPVEVFVCSTSDNYQFLKGMRNL
VAKSGYKLNICHEYVNRGDRWMQDELEFGYIDSPHHRFPVVLDSPRDGELANFPYDELLG
PDFGYVTRVALDEHVSSLDSFGNLEVSPPVTVNGKKYPLGRIIIGVAFPTATKGRNMTKV
VQDFLWAQKVQEPIALFSDWLLVGHVDEFMTFVPAPDRKGFRLLLSSPDAGYKLFRGLQS
SGHGQATLFDGLTNAEQITLDEILKDEKLQAENNYVQSCIDWNRDVLKRELGLDDEDIID
LPILFKLVEDEKEYRAVAYYPDMVNMIVLGKNLGIPKPFGPKVNGRCALEAEMCSLMQGL
GLNCTFIDDYSSYHQLLGEVHCGSNVRREPFEFKWWNLEM
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagacgtttaccaaaccaatgtccctccacatatacctactttcttaaataag
aaaagaaaagttaccacgggtagtcaacttacatgtcgtctagacacacaaaaaacgcag
caacttctctacgttgttggaacctctttgacagcaaaggtgaacaggagtgcccctccc
acctccaagttcttctccgtgaaaggcactgccaatgttcagtacagcatcagccccact
cctcgggacacatcccacctctctcccatccctctcactgaaaactcagtcctgctcatc
agcagggaccatgccagtcaacatgaaaatgatagcaagctgtcagtccagtactatggg
gcgaataaagaggtcttagggagagcagttgtgcatctgacagctgttgagctctcactg
gatgtcgatgctgatagagatggcatcgtggagaaaaacaaccctaaaaagggttcttgg
aaatggggtcctaatgggcatggggccatccttttggtcaactgtgactcagaaaagacc
tacaagaagacaccagacagcgaggacaaaagcatttataaagtgtctgatctaaaggac
atgtctgtcatggtgctgcggaccaaaggcccgggtaaactcccagagggctacaaacta
accatgcacatctctcagggagatgcagagagtgttcgagtcttcagaaaccgatccact
gaagtgtcaaatagtggcctatcgcagaaactttacaatctctttgtgaaagactatcca
ctggtgctgagcagtgatgtgctgtccaaggaagtgccttaccttggaggcgtggcagag
atgaacttttatgtggagggcctgaggtttcctgacaaagacttcaatggactcgtcacc
atcaacctcagtctattagaaccaatctctgatggtctccctgagacgccgatttttact
gacaaagttgtgtttaaagtcgcaccatggatcatgacacccaacacgcttcgacctgta
gaggtgtttgtctgcagcacatctgataactaccagttcctgaaaggaatgaggaacctt
gttgcgaagagtgggtacaagctgaacatttgtcatgaatatgtaaacagaggtgaccgc
tggatgcaggatgaactggaatttggttacatcgattcacctcatcatcgttttcctgtt
gttctggattccccgagagatggcgagctagcaaactttccatacgatgagctgcttggt
cccgactttggctatgtgacaagggtggccctagatgaacatgtgagcagtttagattcg
tttggcaatctggaggtcagtcctcctgtcacagtaaatggaaaaaaataccccctgggt
agaatcatcattggggttgccttccctacggcaactaaaggacgaaatatgaccaaagta
gttcaagactttttgtgggctcagaaggttcaggagcccattgccttgttctctgactgg
ctccttgttggccacgtggatgaattcatgactttcgttcctgcacctgacagaaagggc
ttccgactgctgttgtccagcccagacgcaggttacaaactattcagaggcctacagagc
agtggacacggacaagccacgttgtttgatgggttgacaaatgcagaacaaataacactg
gatgaaatccttaaggatgaaaaactccaagctgaaaataactatgtacagagctgcatc
gactggaaccgggatgtgttgaagagggaactaggcctagacgatgaagacatcattgat
ctgccaatcctcttcaaactagtggaggatgaaaaggagtatagagcagtagcttactac
cccgacatggtgaacatgattgttttggggaaaaaccttggtatcccaaagccctttggc
cccaaagtgaatggacgatgtgcactcgaggctgagatgtgctctctaatgcaaggcctg
ggcctcaactgcacgttcattgacgactattcatcctaccaccagctgttgggagaggtc
cactgtgggtccaatgtccgcagggagccctttgagttcaagtggtggaacctggagatg
taa

DBGET integrated database retrieval system