KEGG   Maylandia zebra (zebra mbuna): 101476244Help
Entry
101476244         CDS       T02814                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101476244
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101476244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 EMP70
Motif
Other DBs
NCBI-GeneID: 101476244
NCBI-ProteinID: XP_024658524
Position
LG6
AA seq 247 aa AA seqDB search
MECREAVVSYLSWGLVVGGGAHLLRQNCAQYGRYAPTKTRCCPARLGWFLQEVPALLVPL
LLLLLSAETGTGRRLLIGTFMLHYFHRSIIYAFLTRGRPIPLIIIVYAVIFCSLNGFLQG
HFLLHCARFEDTWLTRARLTAGIVVFALGMIINIHSDYILRGLRKPGEVIYRVPHGGMFE
FVSGANFFGEIVEWCGYAVAVWSLPAFAFAFFTLCSIGARACMHHRNYQQRFEDYPRSRK
AIIPFIL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggagtgccgcgaggccgtcgtgtcttacctgagctggggtctggtggtgggtgggggc
gctcaccttctgcggcaaaactgcgcacagtacggccgctacgcgcccacgaagacgcgc
tgctgcccggccaggctcggctggttcttgcaggaggtgccggctctccttgtgccgctg
ctgctgttgctgctctccgcggagaccgggaccgggaggaggctgctgatcggcaccttc
atgctgcactacttccacaggagcataatctacgccttcctgaccagaggacgacccatc
ccgctgatcatcatagtctacgccgtaatcttctgctcgctcaacggtttcctgcagggc
cacttcctgctacactgcgctcgctttgaggacacctggctgacccgcgcccgcctcact
gcaggtattgttgtgtttgcactcggtatgatcatcaacatccacagtgactacatcctg
cgtgggctgaggaaacctggagaggttatctacagagtcccccatgggggcatgttcgag
tttgtgtctggggcaaacttcttcggggagatcgtggagtggtgtggatacgctgtagct
gtctggtctttgccagccttcgccttcgccttcttcaccctctgctccatcggggcccga
gcctgcatgcaccacagaaactaccagcagaggttcgaggactaccctcgctccaggaaa
gccatcattcccttcatcctgtga

DBGET integrated database retrieval system