KEGG   Maylandia zebra (zebra mbuna): 101476849Help
Entry
101476849         CDS       T02814                                 

Definition
histone acetyltransferase KAT5-like
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101476849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 522 aa AA seqDB search
MTKMADNSSSVEIVEGCRLPVLRKNQEHEDEWPLAEILSVKEVSSRKLYYVHYIDFNKRL
DEWVTTERLDMKKLQFPKKDAKTPTKNGLSGSRPSSPERDREREREREREREREREREVR
KSLDLNVQTATAPSRGKTLPTPVQKRKVEPAPVAPQVPPVIPVPSLPSSAEATQAAVFPA
VRETPTFKSREDHELTTNGNARRLIPAPPGRKRKANCGGTDEMIKVLQYNKPQSASVFLP
PPEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQEL
TSLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKNYSQ
NLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTLP
PYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKPDNG
ERPQITINEISEITSVKKEDVISTLQYLNLINYYKVRDEHQL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatggcggacaactcatcttcggtcgagattgtggagggctgtcgcctcccg
gttcttcgtaaaaaccaagaacacgaagacgaatggccactggctgaaatcctgagtgtg
aaggaagtttctagtagaaagctctactatgttcactacattgacttcaacaaacgtctg
gatgagtgggtcacaacagaaaggctggacatgaagaagcttcagttccccaagaaagat
gctaaaacaccaaccaagaacggtctttcaggttcccgtcctagttctccggagagagac
agagaaagagagagagaaagagagcgagagagagagagagagagagagagagaagtgagg
aagagtctagatctcaacgtacaaactgccacagctccttccagaggcaaaaccctcccc
acgccggtacaaaagaggaaagtagagcctgcccccgtggctcctcaggtacccccggtc
atccctgtgccctccctgccaagttcagctgaagccactcaggcagctgtttttcctgcc
gtgagagagacgcccacctttaagtcccgtgaagaccatgagctcacaacgaatggcaac
gcccgacgactcatccccgctccacctgggaggaaaagaaaagctaattgtgggggaact
gacgagatgataaaggttttgcagtataacaagcctcaaagtgccagtgtctttctacca
ccaccagaggattcccaggacagctcagatggcattccctctgcaccccgcatgacaggc
agtttagtgtccgatcgcagccatgacgacatcgtcacccggatgaagaacattgagtgt
atagagctgggacggcacagactgaagccttggtacttctctccatacccacaggaactc
acctcgctgcccatcctctacctctgtgaattctgtctcaagtacctcaaaagcctcaag
tgtcttcagaggcatttgaccaaatgtaatctaaggcatcctccaggcaatgagatctac
cgcaaaggcaccatctcattctttgagatcgacggcaggaaaaacaaaaactattcccag
aacctgtgtttactcgcaaagtgtttcctcgaccacaagacgttgtattacgacacagac
cctttcctcttctacgtaatgacagagtacgactccaaaggcttccatatagtgggctac
ttctctaaggaaaaggaatcaactgaagattacaacgttgcctgcatcctcaccttgcct
ccttaccagcgaagaggttacggcaaactgctcattgagttcagttatgagctgtccaaa
gtagaagggaagacgggaactcccgaaaagccgctttctgatctcggtctcttgtcctat
cgctcttactggtcccagaccatcttggaaatccttatggaccttaaaccagacaatggt
gaaagaccacagattaccatcaatgagatcagtgagatcacaagtgtaaagaaagaagat
gttatttcaacacttcagtacctcaacctaatcaactattacaaggtgagagatgagcac
caactgtaa

DBGET integrated database retrieval system