KEGG   Maylandia zebra (zebra mbuna): 101477349Help
Entry
101477349         CDS       T02814                                 

Definition
(RefSeq) histone acetyltransferase KAT2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101477349
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101477349
Transcription machinery [BR:mze03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101477349
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101477349
   HAT complexes
    PCAF complex
     101477349
    STAGA complex
     101477349
    TFTC complex
     101477349
    SAGA complex
     101477349
    SLIK complex
     101477349
    ADA-HAT complex
     101477349
    HAT-A2 complex
     101477349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 101477349
NCBI-ProteinID: XP_004548134
Position
LG22
AA seq 792 aa AA seqDB search
MADSAGIQQGSPAIGAAGLVPAAPGAGGTEGSGAARGSARIAVKKAQLRSSPRPKKLEKL
GVYSSCKAEGACKCNGWKSQNPPPTPPQTEQQSNAVNLQEPCRSCSHTLGDHVTHLENVS
EEEMNRLLGIVLDVEYLYTCIHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPNDDAA
GYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHNSPIWSQDFLAGAAGGQIPIHTVISAASVARPLYYS
TSPVSVDPSTCGSVSPARKAASVLEPNPAGEKRKPSEPLSHEENKRPRVVGDIPMDLINE
VMATIADPAAIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIK
DYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQI
PIESIPGIRETGWKPVGKGKELKDPDQLYSTLKTILQHVKSHQNAWPFMEPVKKTEAPGY
YQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFF
YTKIKEAGLIEK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcgctgggattcagcaaggttcgccggccatcggagccgcgggcctggtt
ccggccgctcctggagccggaggcacggagggctcaggcgccgctagaggatccgcacgt
atcgccgtgaagaaggcacaactacgctcctcgcctcggcccaagaaactggaaaaactc
ggagtgtattcatcctgcaaagctgaaggagcctgtaagtgtaatggctggaaaagtcag
aacccccctcctacacctcctcaaacagagcagcagtccaacgcagtcaacctccaggag
ccctgtcggagctgctctcacactttgggtgatcatgtgacccatctagaaaatgtttca
gaggaggaaatgaacaggcttcttggcattgttctggatgtggagtatctgtacacgtgc
attcacaaagaggaggatgctgacactaaacaagtctacttttccctcttcaaactgctg
aggaagtccatcctacagatgggtaaaccaatgttagaagcacaggagagtccgccgttt
gaaaagcccagcatcgagcagggggtgaacaattttgtccagtacaaattcagccacctg
ccatctaaagaacgccaaaccattatggagctggctaagatgtttctcaaccagatcaac
tactggcagttggaaacgccctctcaaagacgccaaagggtgcccaatgacgacgcagct
ggatacaaagtcaactacactagatggctctgctactgcaatgttcctcagttctgtgac
agcctgccccgctacgagaccactcagatctttgggcggacgcttttgcgttctgtcttc
actgtgatgaggaaacagctgctggagcaggccagacaggagaaggacaagctccctcct
gagaaacgcacactcattcttacacactttcccaagttcttgtcaatgctggaggaggag
gtttacagtcataactctccaatctggagccaagacttcttggcaggggcagcgggaggg
cagattcctatccacacagttataagtgctgcttcagtggccaggccgctgtactacagc
accagtcccgtgtcagtggacccgtccacctgcggcagtgtcagtcctgccaggaaggca
gcttctgtactggagccaaacccagctggagaaaagcgtaaaccttctgagcccctttcc
catgaggaaaacaagagacccagggtggttggtgacatccccatggacctcatcaatgaa
gtcatggcgactatcgctgatcctgctgccattccagagactagcctgctatcagctcac
tctgcacgtgacgaagccgcccgcctggaggagcgcaggggcgtgattgaattccacgtc
attgggaactccctaaaccagaagcccaacaagaggatcttgatgtggctcgtcggcctt
cagaacgtgttctcccatcagcttccccgcatgcccaaggagtacatcacgcggctggtg
ttcgatccgaaacacaaaacgctgtccctgatcaaggacgggagagtgatcggagggatc
tgtttccggatgtttccatcgcaaggcttcacagagattgtcttctgtgccgtcacctcc
aatgagcaggtcaagggttatggaacacatttgatgaaccacctgaaagaatatcacata
aagcatgaaatcctcaattttctcacttacgctgatgaatacgccattgggtactttaag
aaacagggtttctcaaaagacataaaggttcccaagtccaagtatgtgggctacatcaag
gattatgaaggagccacactcatgggctgtgagctcaaccccagcatcccctacacagag
ttctctgtcatcatcaagaagcagaaagagataatcaagaagctgattgagaggaaacag
gctcagatcagaaaagtctatccagggctgtcctgttttaaggatggagtccggcagatt
cccattgagagcattcctggcatacgtgaaactggctggaagcctgtgggcaaagggaaa
gaactgaaagaccccgatcaactgtatagcactctgaaaactatcctccaacatgtgaag
agtcaccagaatgcctggccttttatggagcctgtgaaaaaaacagaagcacctgggtac
taccaagtcatacgcttccccatggacctcaagacaatgagcgagcgtctaaagagccgg
tactacacgacacggaagctttttatggccgacatgcagcgaattttcacaaactgtcgt
gaatacaaccctccagagagcgagtactacaagtgtgcgaacctactggagaagttcttc
tacactaagatcaaagaggcgggcctaattgagaagtaa

DBGET integrated database retrieval system