KEGG   Maylandia zebra (zebra mbuna): 101477349Help
Entry
101477349         CDS       T02814                                 

Gene name
kat2b
Definition
(RefSeq) histone acetyltransferase KAT2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101477349 (kat2b)
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101477349 (kat2b)
Transcription machinery [BR:mze03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101477349 (kat2b)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101477349 (kat2b)
   HAT complexes
    PCAF complex
     101477349 (kat2b)
    STAGA complex
     101477349 (kat2b)
    TFTC complex
     101477349 (kat2b)
    SAGA complex
     101477349 (kat2b)
    SLIK complex
     101477349 (kat2b)
    ADA-HAT complex
     101477349 (kat2b)
    HAT-A2 complex
     101477349 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 792 aa AA seqDB search
MADSAGIQQGSPAIGAAGLVPAAPGAGGTEGSGAARGSARIAVKKAQLRSSPRPKKLEKL
GVYSSCKAEGACKCNGWKSQNPPPTPPQTEQQSNAVNLQEPCRSCSHTLGDHVTHLENVS
EEEMNRLLGIVLDVEYLYTCIHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPNDDAA
GYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHNSPIWSQDFLAGAAGGQIPIHTVISAASVARPLYYS
TSPVSVDPSTCGSVSPARKAASVLEPNPAGEKRKPSEPLSHEENKRPRVVGDIPMDLINE
VMATIADPAAIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIK
DYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQI
PIESIPGIRETGWKPVGKGKELKDPDQLYSTLKTILQHVKSHQNAWPFMEPVKKTEAPGY
YQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFF
YTKIKEAGLIEK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagcgctgggattcagcaaggttcgccggccatcggagccgcgggcctggtt
ccggccgctcctggagccggaggcacggagggctcaggcgccgctagaggatccgcacgt
atcgccgtgaagaaggcacaactacgctcctcgcctcggcccaagaaactggaaaaactc
ggagtgtattcatcctgcaaagctgaaggagcctgtaagtgtaatggctggaaaagtcag
aacccccctcctacacctcctcaaacagagcagcagtccaacgcagtcaacctccaggag
ccctgtcggagctgctctcacactttgggtgatcatgtgacccatctagaaaatgtttca
gaggaggaaatgaacaggcttcttggcattgttctggatgtggagtatctgtacacgtgc
attcacaaagaggaggatgctgacactaaacaagtctacttttccctcttcaaactgctg
aggaagtccatcctacagatgggtaaaccaatgttagaagcacaggagagtccgccgttt
gaaaagcccagcatcgagcagggggtgaacaattttgtccagtacaaattcagccacctg
ccatctaaagaacgccaaaccattatggagctggctaagatgtttctcaaccagatcaac
tactggcagttggaaacgccctctcaaagacgccaaagggtgcccaatgacgacgcagct
ggatacaaagtcaactacactagatggctctgctactgcaatgttcctcagttctgtgac
agcctgccccgctacgagaccactcagatctttgggcggacgcttttgcgttctgtcttc
actgtgatgaggaaacagctgctggagcaggccagacaggagaaggacaagctccctcct
gagaaacgcacactcattcttacacactttcccaagttcttgtcaatgctggaggaggag
gtttacagtcataactctccaatctggagccaagacttcttggcaggggcagcgggaggg
cagattcctatccacacagttataagtgctgcttcagtggccaggccgctgtactacagc
accagtcccgtgtcagtggacccgtccacctgcggcagtgtcagtcctgccaggaaggca
gcttctgtactggagccaaacccagctggagaaaagcgtaaaccttctgagcccctttcc
catgaggaaaacaagagacccagggtggttggtgacatccccatggacctcatcaatgaa
gtcatggcgactatcgctgatcctgctgccattccagagactagcctgctatcagctcac
tctgcacgtgacgaagccgcccgcctggaggagcgcaggggcgtgattgaattccacgtc
attgggaactccctaaaccagaagcccaacaagaggatcttgatgtggctcgtcggcctt
cagaacgtgttctcccatcagcttccccgcatgcccaaggagtacatcacgcggctggtg
ttcgatccgaaacacaaaacgctgtccctgatcaaggacgggagagtgatcggagggatc
tgtttccggatgtttccatcgcaaggcttcacagagattgtcttctgtgccgtcacctcc
aatgagcaggtcaagggttatggaacacatttgatgaaccacctgaaagaatatcacata
aagcatgaaatcctcaattttctcacttacgctgatgaatacgccattgggtactttaag
aaacagggtttctcaaaagacataaaggttcccaagtccaagtatgtgggctacatcaag
gattatgaaggagccacactcatgggctgtgagctcaaccccagcatcccctacacagag
ttctctgtcatcatcaagaagcagaaagagataatcaagaagctgattgagaggaaacag
gctcagatcagaaaagtctatccagggctgtcctgttttaaggatggagtccggcagatt
cccattgagagcattcctggcatacgtgaaactggctggaagcctgtgggcaaagggaaa
gaactgaaagaccccgatcaactgtatagcactctgaaaactatcctccaacatgtgaag
agtcaccagaatgcctggccttttatggagcctgtgaaaaaaacagaagcacctgggtac
taccaagtcatacgcttccccatggacctcaagacaatgagcgagcgtctaaagagccgg
tactacacgacacggaagctttttatggccgacatgcagcgaattttcacaaactgtcgt
gaatacaaccctccagagagcgagtactacaagtgtgcgaacctactggagaagttcttc
tacactaagatcaaagaggcgggcctaattgagaagtaa

DBGET integrated database retrieval system