KEGG   Maylandia zebra (zebra mbuna): 101477580Help
Entry
101477580         CDS       T02814                                 

Definition
eukaryotic elongation factor 2 kinase-like
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     101477580
Protein kinases [BR:mze01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   101477580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 810 aa AA seqDB search
MIHACFGHTLTWLSPGSLTVHSACDCFFPTSSPFSHSVVKTATETMEDELMFSMEEDGSA
KRPSAQRSALKHRASSLSESNASEDDDEDHFICPILDDSAKEVCSYLKNLVYTRQLSNSL
PKSNFMYRNEKETDTVAGHRSYKVLSESARATWLHAIEKAKAMPDPWAQFHLEEIATEPC
IRYRYNAVTGEWVQDQIHMKMGTQPFGKGAMRECFRAKKLSNFSHSSNWKSASNYVAKRY
METVDRNVYFEDVRLQMEAKLWGEEYNRHRPPKQVDIMQMCVVEMTNRPSKPLFHLEHYI
EGKYIKYNSNSGFVRDDNIRLTPQAFSHFSFERSGHQLIVVDIQGVGDLYTDPQIHTAKG
TDFGDGNLGVRGMALFFHSHLCNKICKSMGLTPFDISPAEMSQLDGTNKLLKSAQTVLRG
SEEHCGSPRVRTMSASRAPPLLSRLSETSSADESMSDMESIPCSPLILPCSPPTAAGSIG
SSFIGMYEHDRISNTSEHRESENGGDSGYPSERRSEGDPNDHIDGIHHRYNRQYSESDEE
SVRRRKMVTPPRVSANLNSNTPDNEWLTEEKWTFYHSSRAHVHRPSCVATEVERLNNLLQ
KKIGQSILGKVHLAMVRYHEAGRFCEKDEQWDQESAMYHLERAAMCGELEAIVALGQCCL
QLPHHILPDMELEDNAGNRMRGFKYLLQAAEAGDRSSMIIVARAFDTGVGLSADRKQDWA
EAVHWYNSALNMMDYDEGGEFDGTQDEPRHLLLAREAEMYQEGGHNLAADPQRAGDLFTE
AAEAAMAAMKGRLANQYYMKAEEAWAQMEE
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgatccatgcttgttttggacatacactaacatggctgtcacctggttccctgactgtg
cactctgcatgtgactgttttttccctacttccagtccattctcacactctgttgtcaaa
acagcaacagaaaccatggaggacgaactcatgttcagcatggaggaggatggcagcgcc
aagagaccctctgcccagcggagtgccctcaaacacagagcatcctccctcagcgagtcc
aacgccagcgaggatgatgacgaagaccacttcatctgccccatcctggacgattcggcc
aaagaagtgtgcagctaccttaaaaacctggtttacacacggcagctgtcaaactcgctc
cctaaatccaacttcatgtacaggaacgaaaaagaaacagatacagtggcaggacatcga
tcgtacaaggttttgtctgagagtgcacgggcaacatggctgcacgctatcgaaaaggca
aaagcgatgcccgacccctgggcgcagtttcacctggaggagatagcgactgaaccctgc
attcgttacaggtacaatgccgttacaggggaatgggttcaagaccagatccacatgaag
atgggtacacagccttttgggaaaggggccatgagggagtgcttcagagcgaagaagttg
tcgaatttctcacacagcagcaactggaagtcggcgtccaactatgtggccaagcgttac
atggagacggtggatagaaatgtttactttgaggacgtcaggctgcagatggaggccaaa
ctttggggcgaggagtacaatcgccaccgacctcccaaacaggtggacatcatgcagatg
tgtgtggtggagatgacaaaccgacccagtaaacctctcttccacctggagcattacatc
gagggcaagtacatcaagtacaactccaattctggctttgtcagggacgacaacatccgc
ctcactccacaggccttcagtcacttcagctttgagcggtcgggccaccagctgatcgtg
gtggacatccagggagtcggcgatctctacaccgaccctcagatccacacagcgaagggg
accgactttggagacggaaatctaggtgtgcgaggcatggccctgttcttccactcgcat
ctgtgtaacaagatctgcaaaagcatgggcctgacgcctttcgacatttcccctgcggag
atgtcccagctggacggcaccaacaaactgctcaagtcagcccagactgtgctgagaggc
tcagaggagcactgcggttctcctcgtgttcgcaccatgtcggccagccgggcgcctccg
ctcctatcccgcctgtctgagacctcgtctgcagatgagagcatgagcgacatggaatcg
atcccctgctcccctctcatccttccctgctcccccccaactgcagctggctctataggc
tcgtcttttatcggaatgtatgaacacgacagaataagcaacacaagcgaacacagggaa
tcagaaaacggcggggacagcggctacccgagcgagaggaggagtgaaggagacccaaat
gaccacatagacgggatccatcatcgctacaacagacaatattcagaatcggacgaggaa
agtgtcagacggaggaagatggtaactcctccaagagtctctgcgaacttaaactcaaac
actcctgacaacgaatggttgaccgaggagaagtggaccttctatcactcatcccgcgct
cacgtccaccgaccttcctgtgtggccaccgaggtggaacgactcaacaatctgctgcag
aagaagatcggccagtcgattcttggaaaagtccacttggctatggtccggtaccacgaa
gcgggtcgtttctgcgagaaggacgaacaatgggaccaggagtcggccatgtaccacctg
gagagagctgccatgtgtggagaactggaggccatcgtagctttgggacagtgctgtctg
cagctacctcatcatatactgccagacatggagctggaggataatgcaggaaacaggatg
agaggtttcaagtatctgctgcaggctgctgaggctggcgacagatcttctatgatcata
gtggccagagcctttgatactggagtcggtctgtctgctgacagaaagcaggactgggcc
gaggcggttcactggtacaacagtgcgctgaacatgatggactacgacgaaggaggagag
ttcgatgggacccaggacgagcctcgccaccttctgctggccagagaggcagagatgtac
caggagggaggccacaacctcgccgcagacccacagagagcaggtgacctttttactgaa
gctgcagaagccgccatggcggccatgaagggtcgactggctaaccagtactacatgaaa
gctgaagaagcctgggcacaaatggaggagtaa

DBGET integrated database retrieval system