KEGG   Maylandia zebra (zebra mbuna): 101477834Help
Entry
101477834         CDS       T02814                                 

Definition
(RefSeq) creatine kinase B-type
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00330  Arginine and proline metabolism
mze01100  Metabolic pathways
Module
mze_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101477834
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     101477834
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101477834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 101477834
NCBI-ProteinID: XP_004573201
Position
LG15
AA seq 381 aa AA seqDB search
MPFGNTHNKLKLKYTAEQEYPDLSQHNNHMAKVLTSEMYANLRDKETPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEETYEVFKDLMDPVIEDRHGGYKPTDKHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRTIENLSIETLASLEGDLKGKYYALKNMT
EEEQQQLIDDHFLFDKPVSPLLLASGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMREVFTRFCTGLTKIEELFKERGHEFMWNEHLGYILTCPSNLGTGLRAGVHVKLP
NVSKHEKFGEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGINLL
VEMEKRLEAGESIDDMMPEQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccttttggaaacacccacaacaagttgaagctgaagtacacggcggagcaggagtac
cccgacctcagccagcacaacaaccacatggccaaggtgctcacgtccgaaatgtacgcc
aacctgagggacaaggagacgcccagcggattcaccctggacgatgtcatccagactggc
gttgacaacccaggtcatccgtttatcatgactgtgggctgtgtggctggagacgaggag
acgtatgaagtgtttaaagacctgatggatccagtgatcgaagaccgccatggaggatac
aaaccaacagacaaacacaagacggacctgaaccctgacaacctccagggtggagatgat
ctggatccaaactatgtgctcagctctcgggttcgcacaggacgcagcattcgtggcttc
tgtctgccgccacactgcagccgtggagagcgacgcactattgagaacctctccattgaa
actctggcctccttggaaggagacctgaaggggaagtactatgctctgaagaacatgacc
gaggaggagcagcagcaactcattgatgaccacttcctgtttgataagcctgtgtccccg
ctgctgctggcgtccggcatggcccgcgattggcccgatggccgtggcatctggcacaat
gacaataagacattcctggtttgggtgaacgaggaggatcatctgcgtgtcatcagcatg
cagaaaggaggaaacatgagggaggtgttcacccgcttctgcactggcctcaccaagatc
gaggaactgtttaaggagcgaggtcatgaattcatgtggaacgagcacctgggctacatc
ctcacctgcccgtccaacctgggcaccggcctgcgagctggcgtccacgtcaagctgcca
aacgtgagcaagcacgagaagttcggcgagatcttgaagaggctgcggctgcagaagcga
ggaacaggtggtgtggacactgcagcagtgggtggagtctttgacatctccaacgcggac
cgcctgggtttctcagaggtggagctggtgcaaatggtggtggatggcattaacctgctg
gtggagatggagaagcggctggaggccggagagagcatcgatgacatgatgcctgaacag
aagtga

DBGET integrated database retrieval system