KEGG   Maylandia zebra (zebra mbuna): 101478049Help
Entry
101478049         CDS       T02814                                 

Definition
protein-glutamine gamma-glutamyltransferase K-like
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101478049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 783 aa AA seqDB search
MPAERRSARGRSAVGRFPSVTFGFGEDTEAEKEEPKENNVKKGNACKEWLRKVCPCCCPK
HDDGIDTEVTLVDGPGKEDGGNGEKPVPGDKELDEVLLKVKSIDLLKSKSGANRTEHHTH
LYQSDNLIIRRGQSFEMWITLSRPFNPSSDELHLDLKTGPLAVVAKGTHVIIPLVAKLEG
DRWEAAVVKQEDKKIKLLVNSPATAVIGRYQLTVETNNQNGSASSTHDPANDIYILFNPW
CQDDIVYMDSEDERQEYILNDTGRIYYGTKDQIGARTWNYGQFSDRILAACLFVMEKSGT
SPSGWGDPVNVVRIISAMVNSPDDQGVLEGNWSGDYSNGTSPTVWSGSVEILEEYHKKNG
TPVKYGQCWVFAGVVTTVLRCLGIPTRTVTNFSSAHDTDVSLTTDVYLDENLEPIENLNV
DSIWNFHVWNDCWMARKDLPPGHGGWQAVDATPQETSQGTYCCGPASLAAVRYGQVYLKS
DTAFVFAEVNSDKIYWQKNADGTFTQIYSEKKIVGISISTKAVGSNERSDITHLYKHPEG
SNEERIAVETACSFGSKAKAYSSPTAQDVSLEVTLDGEGPKMGKDAELMITLKNSSSQQR
SVSLHSQVSVMYYTGVHKATVRTDTTDIEVLPNEGEWXLEYKDYKDKLIDQAALMLTVSG
RVTETQQILATQFSFRLRTPDLIIKPLGKAVVGEKMSVEISFTNPLPQVLKAVIFHVEGL
GLLTARMINYGDIGSQASVSLTEQFIPTLSGTRKLLVSLDCKQLTQVHGVSDITVEEKSN
APL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagagaggcgatcagcaagaggcagatctgcagtaggtcgctttccatctgtc
acttttggatttggggaggacacagaggcagaaaaagaagagccaaaggaaaacaatgtt
aaaaaaggaaatgcatgcaaggagtggctgcgtaaggtctgcccatgctgctgtcccaag
catgatgatggcatagacactgaggtcacgctggttgatgggccgggtaaggaggacggg
ggaaacggcgagaaacctgtgcctggtgacaaagagcttgacgaagtccttctcaaagtg
aagtcaatagacctcctgaaaagcaaatcaggggcgaatcgcacagagcatcacactcat
ctctaccaaagtgataatttaatcatccgcagggggcagagtttcgagatgtggataacc
ttatctcgacctttcaacccctcctccgatgagcttcatctcgaccttaaaacaggtcca
ttggcagtagtggcaaagggaactcatgtaatcatcccactggtggcgaagctggagggt
gatcgctgggaggctgctgttgtgaaacaggaggacaaaaagataaaactgttggtgaat
tctccagccacagccgtcattggccgatatcaactcacagtggaaacaaataatcaaaat
ggatcggccagttccacacatgaccctgccaatgacatctacatattgtttaacccctgg
tgtcaagatgacattgtgtacatggattctgaagatgaaaggcaagagtacatcctaaat
gacactggacgaatctactatggcacaaaggatcaaattggagcgaggacatggaactac
ggacagtttagtgacaggattctggctgcttgcctctttgtcatggaaaagagtggaact
tctccatctgggtggggtgacccagttaatgtggtgcgaatcatctcagcaatggtaaac
tcccctgatgaccaaggtgttttggagggaaactggtcaggagattattcaaatggaact
tctccaacagtgtggagtggaagtgtagaaatccttgaggaataccacaaaaagaatgga
acccctgttaaatatggccagtgctgggtgtttgctggtgtagtcacaacagttttacgg
tgtttaggcattcccacccgaaccgtgaccaacttcagctcagcacatgacacagatgtt
tcattgacaacagatgtgtacctggatgagaacctggagcctatagagaacctcaatgtg
gactcaatttggaacttccatgtgtggaatgactgctggatggctcgtaaggacttacct
cctggccacggaggatggcaggctgtcgacgccacgcctcaagagaccagccagggcacc
tactgctgtggccctgcttctctcgccgctgtgcgctatggtcaggtctacctgaaaagt
gacacagcttttgtgtttgctgaggtgaacagtgataaaatctactggcagaagaatgca
gatgggaccttcactcaaatatacagtgagaaaaagattgtgggcatctccatcagcacc
aaagcagttggctctaatgaacgcagtgatatcacccacctttacaaacatcctgaaggc
tcaaatgaggaacgcattgctgtggaaacagcatgtagctttggctccaaagcaaaagct
tattcatctcctacagctcaggatgtctctttagaagttacgctagatggtgaaggtcct
aaaatgggaaaagatgcagagctgatgatcacgttgaaaaacagcagttcacagcaacgc
agtgtcagtctgcacagccaggtgtcagtcatgtactacaccggtgtccacaaagctaca
gtcagaactgacacgacagatatagaagtacttcccaatgagggtgagtggnncctggaa
tacaaagactacaaggacaaactgatagatcaggctgccctgatgcttacagtatcaggc
agggtcacagaaacacagcagatccttgctactcagttcagtttccgactcagaacacca
gacctcatcattaaaccactggggaaggctgtggtaggagagaagatgtcagtagagatt
tcatttactaatccactgccacaagtgctgaaagcagtgatattccatgtggaaggactt
ggccttctgactgctcgaatgataaattatggagatattggcagccaagcttctgtgtct
ctcactgagcagttcatccccaccctttctggaacgagaaaattactagtttcactggac
tgtaagcagctcacgcaggttcatggtgtgagtgacatcactgtggaggagaaaagcaac
gcccctctatag

DBGET integrated database retrieval system