KEGG   Maylandia zebra (zebra mbuna): 101478115Help
Entry
101478115         CDS       T02814                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101478115
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     101478115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 640 aa AA seqDB search
MKESRHLLQIHRPYSHTKMQPTVVLLFSSIFLLAFIIPFCFSQNEGDLVVQTRTGRVRGI
RQLVPDQNYITAFLGIPFAEPPLGNRRFRPPEPKRPWTGVIEAKEYPNACYQYVDTAFPG
FQGSEMWNPNRDMNEDCLYLNVWVPSSPRPHNLTVMVWIYGGGFYSGSSSLDVYDGRYLA
HSETVIVVSMNYRIGAFGFLALHGSSEAPGNVGLLDQRMALQWVQDNIHFFGGNPKQVTI
FGESAGGASVGFHLLSPDSRPTFTRAILQSGVPNCPWASVSPAEARRRATQLAKFVGCNG
GNDTEIIDCLRSKSPQQLIDHEWQVLPWSALFRFSFVPLVDGEFLPDTPEAMLNSGNFKD
TQILLGVNQNEGSYFLLYGAPGFSKDNDSLISREDFLESVRLSVPHANDIGLEAVVLQYT
DWMDENNEIKNRDAMDDIVGDHNVICPLAHFARSYAQHNALKANVGGINFGGVNSGNSQG
GMYLYLFDHRASNLAWPEWMGVIHGYEIEFVFGLPLVKRLNYTRDEEKLSRRMMKYWANF
ARTGNPNDVQGDRGKRWPVFTVSEQKHVGLNTESLKIHKGLRNQMCAFWNRFLPRLLNIT
DNIDEAERQWKVEFHRWSSYMMHWKSQFDHYSKQERCTDL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtcacgacatctgcttcagatacacagaccatattcgcatacaaagatgcag
cccactgtggttcttctcttctcctcgatcttcctcctggctttcatcatcccattctgc
ttctcccagaacgagggagacctggttgttcagacacgtaccggtcgagttcgaggcatc
cgccagctggtgccggatcagaactacataactgcttttctgggcatcccctttgctgag
cccccactggggaaccgccgtttccgtcctccagaacccaaacgtccgtggactggagtg
atcgaggccaaggaataccccaacgcgtgctatcagtatgtggacacagcattcccaggc
ttccagggcagtgagatgtggaatcctaacagagacatgaatgaggactgcctctacctc
aatgtctgggtgccctcctcgcccagacctcacaacctcactgtcatggtgtggatctat
ggtggaggcttctacagtggatcttcttctctggatgtgtatgatggtcgttacctagct
cacagcgagacagtcattgtggtttcgatgaactaccggatcggtgctttcggcttcctg
gctctgcatggctcctccgaggctcctggcaatgtcggcctccttgaccagaggatggcg
ctgcagtgggtacaagacaacatccatttctttggtggaaaccctaaacaggttacgatc
tttggcgagagtgctggcggagcttcagtaggattccacctgttgtctccagacagccga
cccactttcactagagccatcctccagagcggggtccccaactgcccctgggcctcagtg
agtcccgctgaagcccgcagacgtgctacacagctggcaaagttcgtcggttgcaacgga
ggcaatgacaccgagataatagactgtctgcgcagtaaaagtccacagcaacttatcgat
catgagtggcaggttctgccatggtccgctctgttccgattttcatttgtgcctcttgtg
gatggcgagtttctgcccgacactcctgaggccatgctcaactcagggaactttaaagac
acgcagattctcctcggcgttaatcagaatgaaggctcctacttcctgctgtatggagca
ccaggcttcagcaaggacaacgacagtctgatctccagagaggacttcctggaaagtgtt
aggctgagcgtacctcatgctaatgatatcggcctggaagcagtggtgctgcagtacacc
gactggatggatgagaataatgaaataaaaaaccgtgatgccatggatgacattgtcggt
gaccacaacgtcatctgcccgctggcccacttcgctcgctcttatgcacaacacaatgcc
ctcaaggctaatgtgggtggcatcaactttggtggggtgaacagtggaaactcacaagga
gggatgtatctttaccttttcgatcaccgggcatccaatctggcctggccagaatggatg
ggggtgatccatggctatgagattgaatttgttttcgggctgccactggtgaagaggctc
aactacacccgagatgaggagaagctaagccgacgtatgatgaaatattgggccaacttt
gctcggactggaaatcccaatgacgtgcagggagatagagggaaacgctggcctgtgttt
accgtcagcgagcaaaaacacgttggcctcaacaccgaatcactcaagattcacaaaggt
ttgcgaaaccagatgtgcgcattctggaatcgcttcctgccacgccttctcaatattact
gacaacatagatgaggcagaacgtcagtggaaggtggagtttcaccgctggtcttcctac
atgatgcactggaagagtcagtttgaccactacagcaagcaggagcgctgcactgacctc
tga

DBGET integrated database retrieval system