KEGG   Maylandia zebra (zebra mbuna): 101478598Help
Entry
101478598         CDS       T02814                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101478598
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101478598
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101478598
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101478598
  Exosomal proteins of breast milk
   101478598
Heparan sulfate/heparin binding proteins [BR:mze00536]
 Enzymes (General comment) Variety
  101478598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 515 aa AA seqDB search
MGKQNICFLTAWIILGKIFATFSSDLESNTTAFANTTVTIDQLLNTTEWLTDFTDIVSKF
SLRTADTPDDDMCYIVPGRPETIKECNFNPETQTFIVIHGWTVTGMFESWVPKLVSALYD
RVPTANVIVVDWLSRANQHYPTSAAYTKLVGRDVAKFVTWIQNELQLPWDRVHLLGYSLG
AHVAGIAGDLTNHKISRITGLDPAGPTFEHADEQSTLSRGDAQFVDVLHTNTRGSPDRSI
GIQRPVGHIDIYPNGGTFQPGCDIQNTLMGIALEGIKGLQNMDQLVKCSHERSIHLFIDS
LLNIEQQSVAFRCNSKDTFNKGMCLSCRKNRCNKIGYNVKKVRTARSTTMYLKTRGTMPF
KVFHYQVKAHFFSQNKQSFTEQPMKISLYGTNGEKEDIPFVLPALNSNTTQSFLITTDTD
IGDLMIVKLRWERDAYISWSNWWGSTKFNIRKLRIKCGETQSKVIFNAKDGEFVDLTRGG
ENAVFVKSKEDKQSRKEKLAHKLKTKGSLFGQQEA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaacaaaatatctgctttttaactgcttggataattttgggaaaaatctttgca
actttttcttcagaccttgaatccaacaccaccgcttttgcaaacaccacagtcaccatt
gatcaactgctgaataccactgaatggctcaccgacttcaccgacatcgtgtccaagttc
tccctgcgcaccgcagacaccccggatgatgacatgtgttacatagtacctgggaggccg
gaaaccatcaaggagtgcaactttaatccagaaacacagaccttcattgtgatacacggc
tggacggtaacagggatgtttgagagctgggtgcccaagctggtgtctgctctgtatgac
cgtgtacccactgctaatgtgattgtggtggactggctgtcccgagccaaccagcactac
ccgacctctgccgcctacaccaaactagtgggtcgtgacgtcgccaagtttgttacctgg
atacaaaacgagctgcagttgccctgggacagagttcatctgctgggttatagtctggga
gcgcatgttgctggaattgccggagaccttaccaaccacaaaatcagccggatcacaggt
ctggatcccgccggccccacgttcgagcacgcggatgaacagagcacgctgtcccgaggc
gatgcccagtttgtggatgtcctgcacaccaacaccaggggctccccggaccgcagtatt
ggcatccagagaccagtgggtcacatagatatttaccccaacggaggcaccttccagcca
ggctgcgacatccagaacactttgatgggaattgcattagaaggaatcaaaggcctccaa
aatatggaccagcttgtcaaatgctcccacgagcgctccatccacctgttcatcgactct
ctgctgaacatcgagcagcagagcgtggccttccgatgcaactccaaagacaccttcaac
aagggaatgtgcctcagctgcaggaagaaccgctgcaacaagatcggctacaacgtgaaa
aaagtccgcacggcccgcagcacaacgatgtacctcaagactcgtggaacgatgcctttc
aaagttttccactaccaggtgaaggcacatttcttcagccagaacaagcagagcttcacg
gagcagccaatgaagatttccctgtatggaacaaatggagagaaggaagatattcctttt
gttctaccagccctgaacagtaacaccactcaatccttcctcatcaccaccgacacggat
atcggagacctgatgatcgtgaagctgcgctgggagcgggatgcgtacatcagctggtca
aactggtggggcagcaccaagttcaacatccgaaaacttcgcatcaagtgtggagagact
cagtccaaggtgatctttaatgcaaaggacggagagtttgttgacctcacccggggagga
gagaacgccgtctttgtcaagtcaaaggaagacaaacagagccgtaaagaaaaactggcg
cacaagcttaaaacgaagggcagcctttttgggcagcaggaagcttga

DBGET integrated database retrieval system