KEGG   Maylandia zebra (zebra mbuna): 101478751Help
Entry
101478751         CDS       T02814                                 

Definition
glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic-like
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101478751
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     101478751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 352 aa AA seqDB search
MMATQKKVCVIGSGNWGSAIAKIVGANAAKYDKFDTTVNMWVFEETVNGRKLTEIINTDH
ENVKYLPGHKLPPNVLAVPDLAESVKGADILIFVVPHQFIVRVCDTIKDHIKKDAIGMSL
IKGVDASPEGLKLISEVIRGKLGITMTVLMGANIANEVADEKFCETTIGCKDKEHGLLLK
ELMHTTNFRVTVVEESDVVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMISF
AKVFCTNCPVSPATFLESCGIADLITTCYGGRNRKIGEAFAKTGKTIEQLENELLNGQKL
QGPATATEVHQVLKQKNMVEKFPLFTAVYQICFNGHPVSEFIKCLQNHPEHI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaacacagaagaaggtctgtgtgattggctctggtaactggggctctgccatt
gccaagattgtgggagccaatgcagccaagtatgacaagtttgacaccacagtgaacatg
tgggtgtttgaggagacggtgaacggtcgcaagctcacagaaatcatcaacacagaccat
gaaaatgtgaaatatctgcccggtcacaagttgcctcccaatgtgctggctgttccagac
ttggctgagtctgtgaaaggagctgacatcctgatcttcgtggtccctcaccagtttatt
gtgcgagtgtgtgacaccatcaaagatcacataaaaaaggatgcgataggaatgtctctt
atcaagggtgtcgatgccagtccagaaggtctgaagctgatctcagaggttatccgaggg
aaactgggcatcacaatgacagtcctcatgggtgcaaacattgccaatgaggtcgctgat
gagaagttctgtgaaacaaccattgggtgcaaggacaaagaacatgggttgttgctgaag
gagctgatgcataccaccaacttccgcgtgactgtggtggaggagtctgatgttgttgag
atctgtggcgcactcaagaacatcgtggcagtaggagcaggcttctgtgatggcctggga
tttggagacaacaccaaggcagcagtgattcgtctcggcctgatggagatgatctccttt
gccaaggttttctgcactaactgccccgtctcacctgccaccttcctggagagctgtggc
atcgccgacctcatcacaacctgctatggtggacgcaaccgaaagattggagaggcattt
gccaaaacgggcaaaaccatcgagcagttggagaacgagctgctgaatggtcagaagctt
cagggcccagcaacagcaactgaggtccaccaggtcttgaaacagaaaaacatggtggag
aagtttcctcttttcactgccgtttatcagatctgcttcaatggccacccagtctcagag
ttcatcaagtgcttgcaaaaccacccggagcacatttga

DBGET integrated database retrieval system