KEGG   Maylandia zebra (zebra mbuna): 101478877Help
Entry
101478877         CDS       T02814                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00040  Pentose and glucuronate interconversions
mze00053  Ascorbate and aldarate metabolism
mze00140  Steroid hormone biosynthesis
mze00830  Retinol metabolism
mze00860  Porphyrin and chlorophyll metabolism
mze00980  Metabolism of xenobiotics by cytochrome P450
mze00982  Drug metabolism - cytochrome P450
mze00983  Drug metabolism - other enzymes
mze01100  Metabolic pathways
Module
mze_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101478877
   00053 Ascorbate and aldarate metabolism
    101478877
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101478877
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101478877
   00860 Porphyrin and chlorophyll metabolism
    101478877
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101478877
   00982 Drug metabolism - cytochrome P450
    101478877
   00983 Drug metabolism - other enzymes
    101478877
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101478877
Glycosyltransferases [BR:mze01003]
 Others
  Hydrophobic molecule
   101478877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 101478877
NCBI-ProteinID: XP_004556232
Position
LG7
AA seq 538 aa AA seqDB search
MMQVSTSLPLLFLPLTLLLLHPVSLVHGGHVLAFPGEFSHWLNMRNIIEELVKRNHSVTI
LVPDASPSVNYNNSRDAAKFNFLVFKVSYSREEYVGTMHEFIQFSMYESHTSSPLQKIMK
MNDFMGRTLDFGRQQCDGVLKNQQLMATLQDSAFDAILQDPLAMCGDLVADMLGVPLILS
LRFSFGSVMERHCGHAPLPPSYVPLAPLPYNDRMTFVERLINMVTYVASSTLTELAWKLS
VNKYYSEIKGTPSSVCETMGKADVWLIRTFWDIETPRPTPPNFKYVGGLHCKPANQLPED
LEAFVQSSGDAGIIVASFGSMVTNLTMQHANIIATAFGQIPQKVIWRYRGEAPTALAPNT
KISDWIPQNDLLGHPKTKAFVTHGGTNGLYEAVFHGVPLVGVPLFGDQPDNLARMSRLGT
AIVLDFNHLTAEELAEALHVVTNQPSYRTNMQRLSAVHRDQPVTPLSTAVFWVEFVMRHG
GARHLRLASYDLNWFQYHSLDTGAALLVALMTIAALWWVGIRCILRQCRQRAGREKKD
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggtttccacgtctcttcctcttctttttcttcccctcaccctcctgctcctt
catcccgtctccctggtacatggtggccatgttctggcatttccgggagagttcagccat
tggttgaacatgcggaacatcatagaggagctggtgaagaggaatcattcggtcaccatc
ttagtgcccgatgcatcgccgtctgtcaactacaacaacagccgtgacgctgccaagttc
aacttcctggtcttcaaggtgtcatatagcagggaggaatatgtgggcaccatgcacgaa
ttcatccagttctctatgtacgagtcacacacctcttcaccgctgcaaaagatcatgaag
atgaacgatttcatgggccgcaccctggactttgggaggcagcagtgtgatggggtgctg
aagaaccagcagctgatggcgactctgcaggacagtgctttcgatgctatcctacaagac
ccccttgcaatgtgtggcgacctggtggctgatatgctcggcgtgccactcatcctctcg
ctgcgcttcagctttggcagtgttatggagcgacactgtggccacgccccgttgccacca
tcttatgttccattagctcctcttccatacaacgaccgcatgacgttcgtggagagactg
atcaacatggtgacatatgtggcgtcatccacgctaactgaacttgcctggaagctgtct
gtgaataaatactatagtgagatcaaaggaactcccagcagtgtgtgtgagactatgggg
aaggccgacgtgtggctcatcaggacgttctgggacattgagacgccacggccgacccca
ccaaacttcaaatacgtgggcggtctacactgcaaaccagccaatcagctgccagaggac
ctggaggcatttgtgcagagttcaggtgatgccggcataattgtggcttccttcggctcc
atggtaaccaacctgacgatgcagcacgctaacatcatcgccaccgccttcggtcagatc
ccacagaaggtgatttggcgttaccgtggcgaggctccaactgcattggcgccaaacaca
aagatttctgattggatccctcagaacgacctgctgggtcacccaaagacaaaggcattc
gtgacacatggcggcactaacggtctgtatgaagctgtgtttcacggtgtgcctctggtg
ggcgtgccactgtttggcgatcagcctgataatctcgcccgtatgagccgcctcggcacc
gccatcgtcctggacttcaaccatctgacagctgaggagctggcagaggcgctgcacgtc
gttacaaaccagccaagctacaggaccaacatgcagcgtctgtcagcggtgcaccgcgac
cagccagtaacaccactgagtaccgccgtcttctgggtggagtttgttatgcgacatggt
ggagctaggcatctgcggttggcatcatacgacctgaactggttccagtaccacagcttg
gacaccggtgctgccctgctggtcgctttgatgaccatcgctgctttgtggtgggtgggg
atacgctgcatcctgcggcagtgcagacagcgagcaggaagagagaagaaggactga

DBGET integrated database retrieval system