KEGG   Maylandia zebra (zebra mbuna): 101478924Help
Entry
101478924         CDS       T02814                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101478924
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101478924
Glycosyltransferases [BR:mze01003]
 Glycan extension
  Type 3 chain
   101478924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 396 aa AA seqDB search
MKTLGPRISFYAGFVVGTFTLYVFLRQLWFEKTLPMHQVTTLARIQDYQQQLEEEKKMWK
KEGSALFNLEHPHHIGEDSRMADELYKKVRILCWVMTGPKNLETKTRHAKYTWSRHCNIV
VFMSSVDDPDFPTVGLGTKEGRDQLYWKTIRAYHYAYEHYADEADWFLKADDDTYVIVDN
LRWILANHTPEEPIYFGRRFKPYTKQGYMSGGAGYVLSKEALRRFVEGFKSKQCTHTTSV
EDLAMGQCMEKVGVLAGDSRDSFHRETFHPFVLEQHLTAKFPKSFWYWSYCYYPISEGPN
CCSDMSISFHYVDAVGMYLMEYYTYHLRAFGYRYRYQPPTPPGYSINKFESWDAGKKDKK
LEQKLVHPDLSRTDKRQNEDPPPVDGKDGPAAAEGK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctcggacccagaatctcattttatgcgggctttgtggtgggaacttttacg
ctgtacgtgtttctgcggcagctttggtttgagaagactctgccaatgcatcaagtcacc
accttggctagaattcaggactaccagcaacagctcgaggaggaaaagaaaatgtggaag
aaagaggggtctgcacttttcaacctcgagcaccctcatcacataggtgaggatagccgc
atggctgatgaattgtacaaaaaggtgcgtattctttgctgggtgatgactggacccaaa
aacctggagacgaagactcgacatgcgaagtacacttggagtcgccattgcaatattgtt
gtcttcatgagctctgtggatgaccccgactttcccacagtgggattaggtacaaaggag
ggtcgggatcagctgtactggaaaacaattcgggcctaccattatgcttatgagcattat
gcagatgaggcagattggttcctcaaggcagatgacgacacctacgtcatagtggacaac
ctgcgctggattcttgcaaaccacactcctgaggaacctatttacttcggcagacgattc
aagccctacactaagcagggctacatgagtggtggtgcaggctacgtactgagcaaagag
gctttgcgaagatttgttgaaggttttaaaagcaaacagtgtactcatactacctccgta
gaggacctggcaatggggcagtgcatggagaaagttggggtgctggctggagactccaga
gactcttttcatagggagacatttcacccctttgtccttgagcagcacctcactgccaaa
tttccaaagagcttctggtattggagctactgctactaccccatctcagagggtcctaac
tgctgctcggacatgtcaatatctttccattacgtggatgctgtagggatgtatttaatg
gaatattacacttatcacctgcgtgcctttggctacagatatcgctatcagcctcccacc
ccacctggctacagtataaataagtttgaatcgtgggatgctgggaaaaaagacaaaaag
ctggaacaaaaactagtccatccagacctatccagaactgacaagagacagaatgaagat
ccccctcctgtagatggtaaagatggtcctgctgctgcagagggtaaataa

DBGET integrated database retrieval system