KEGG   Maylandia zebra (zebra mbuna): 101479530Help
Entry
101479530         CDS       T02814                                 

Definition
(RefSeq) ecto-ADP-ribosyltransferase 4-like
Organism
mze  Maylandia zebra (zebra mbuna)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
MGQKRRMLLAAIIFIAVYYKVTAKETRLLDVQKTTNVVDDLYYGCREEAMKKFIESDVLK
QELNNSEGFQKAWNKSIECSKQIPQGRKEHSAALSVYINEDKSFIQTLNKAIETMGGNVS
IYEDHFNLKSLHFLLMDSMRLLKPKECKNVYVFQDGQNQPQKGSTVRFTSFTLAYSDYEE
LKRLEDVNENTILHLTSCFFVNLKDYVCGQEQDEILLSPAEVFTVEQVETKTTSDGDEYL
EIDLKQSGLKSSHNCYIFSRMSVGQETTTAVAERDRSPPAVVATLWLVSVLAALSSVSLA
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaaaagaagaatgcttcttgctgcaataatttttatagctgtctattacaaa
gtgactgcgaaggaaacaagactactggatgtccaaaagaccacaaatgttgtggatgat
ctgtactatggatgccgtgaagaggccatgaagaagttcatcgagtcagatgtgttaaaa
caagaactaaataacagtgaaggatttcagaaagcatggaataaaagtattgagtgttca
aagcagatccctcaaggacgaaaagagcatagtgctgcactttcagtctatattaatgag
gataaatcgttcatacaaacactgaacaaagcaatagagacaatgggtggaaatgttagc
atctatgaagaccacttcaacctcaagtctcttcatttcctgctgatggactccatgagg
ctgctgaagccaaaggagtgcaagaacgtttatgtttttcaagatggtcaaaaccaacca
cagaaaggctccacagtgagatttacaagtttcactttagcttattcagactatgaagag
ctaaagagacttgaagatgtcaatgagaatactattttacatctcacttcatgcttcttt
gtcaacctgaaagactatgtgtgcggtcaagaacaggatgaaatactcttatctccagca
gaagttttcactgtggaacaagtggaaacaaaaactacatcggatggtgacgaatacctt
gagattgatttgaaacagtcgggactgaaaagctcacacaactgttacatcttttcacgg
atgtcagtaggtcaggagactaccacagctgttgcagagcgagacaggtctcctccagct
gttgtcgccaccctgtggcttgtatcagtgcttgcagccttatcttctgtttctttagct
gtttag

DBGET integrated database retrieval system