KEGG   Maylandia zebra (zebra mbuna): 101479530Help
Entry
101479530         CDS       T02814                                 

Definition
uncharacterized LOC101479530
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101479530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
MGQKRRMLLAAIIFIAVYYKVTAKETRLLDVQKTTNVVDDLYYGCREEAMKKFIESDVLK
QELNNSEGFQKAWNKSIECSKQIPQGRKEHSAALSVYINEDKSFIQTLNKAIETMGGNVS
IYEDHFNLKSLHFLLMDSMRLLKPKECKNVYVFQDGQNQPQKGSTVRFTSFTLAYSDYEE
LKRLEDVNENTILHLTSCFFVNLKDYVCGQEQDEILLSPAEVFTVEQVETKTTSDGDEYL
EIDLKQSGLKSSHNCYIFSRMSVGQETTTAVAERDRSPPAVVATLWLVSVLAALSSVSLA
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaaaagaagaatgcttcttgctgcaataatttttatagctgtctattacaaa
gtgactgcgaaggaaacaagactactggatgtccaaaagaccacaaatgttgtggatgat
ctgtactatggatgccgtgaagaggccatgaagaagttcatcgagtcagatgtgttaaaa
caagaactaaataacagtgaaggatttcagaaagcatggaataaaagtattgagtgttca
aagcagatccctcaaggacgaaaagagcatagtgctgcactttcagtctatattaatgag
gataaatcgttcatacaaacactgaacaaagcaatagagacaatgggtggaaatgttagc
atctatgaagaccacttcaacctcaagtctcttcatttcctgctgatggactccatgagg
ctgctgaagccaaaggagtgcaagaacgtttatgtttttcaagatggtcaaaaccaacca
cagaaaggctccacagtgagatttacaagtttcactttagcttattcagactatgaagag
ctaaagagacttgaagatgtcaatgagaatactattttacatctcacttcatgcttcttt
gtcaacctgaaagactatgtgtgcggtcaagaacaggatgaaatactcttatctccagca
gaagttttcactgtggaacaagtggaaacaaaaactacatcggatggtgacgaatacctt
gagattgatttgaaacagtcgggactgaaaagctcacacaactgttacatcttttcacgg
atgtcagtaggtcaggagactaccacagctgttgcagagcgagacaggtctcctccagct
gttgtcgccaccctgtggcttgtatcagtgcttgcagccttatcttctgtttctttagct
gtttag

DBGET integrated database retrieval system