KEGG   Maylandia zebra (zebra mbuna): 101480024Help
Entry
101480024         CDS       T02814                                 

Definition
cytosolic 10-formyltetrahydrofolate dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101480024
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101480024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 902 aa AA seqDB search
MRIAVIGQSLFGQEVYKELRKDGHTIVGVFTIPDKDGKADPLATEAEKDGVPVFKFPRWR
LKGQAIQEVVTQYKATGAELNVLPFCSQFIPMEVIDHPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDTVNTIYKRFLFPEGVKGTVEAV
RLIAEGKAPKITQPAEGATYECIQKKDNAKIDWNQSAEALHNWIRGNDKVPGAWAEVDGQ
KVTFYGSSLVDNGTAVNGQPLEIPGASQPGIVTKSGLVLFGNDGKTLLVKNLQFEDGKMI
AAAQYFRSGSSAAVELTEEEKTFAVQMRAVWQSILSNVSQIEDSTDFFKSGAASMDVVRL
VEEVKLRASSCQLQNEDVYMNTTFQDFIQMCVRKLRGEDDEEELVVDYVEKNINNMTIKM
PHQLFINGEFVDAEGGKTYKTINPTDGTAICDVSLAQISDVDRAVAAAKEAFEEGEWGKM
NPRDRGRLIYRLADLMEEHQEELATIEAIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTFTKKEPMGVCAIVIPWNYPLMMLAWKTAACLAAGNTVVLKPAQ
VTPLTALKFAELAARAGLPKGVINILPGSGALVGQRLSDHPDVRKLGFTGSTEIGKHIMK
SCAVSNVKKVSLELGGKSPLIIFSDCEMDKAVRMGMSSVFFNKGENCIAAGRLFVEDSIH
DLFVQKVVEEVKKMKIGDPLDRSTDHGPQNHKAHLDKLVEYCQTGVKEGATLVCGGRQVQ
RPGFFFEPTVFTDVQDHMYIAKEESFGPVMIISKFKSGEVDDVLRRANATEYGLASGVFT
RDISKALYVSERLNAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGQDALNEYLKTKTVTI
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgcagtgattggtcagagtctgtttggccaggaagtgtacaaggagctaagg
aaggatgggcacaccattgtaggagtcttcacaatccctgacaaggatggcaaggcagat
ccactggccacagaagcggagaaggatggcgtgcctgtctttaagttcccccgctggcga
ctcaagggccaggctattcaggaggtggtgactcaatacaaggctacaggtgcggagctc
aacgtcctgcccttctgctcccagttcattcctatggaggttatcgaccacccaagacat
ggctccatcatctaccacccatccctactgcctcgccacaggggagcctctgctatcaac
tggacactgatccacggtgacaaaaagggcgggtttacagtgttctgggctgatgacgga
ctggatactggtcccatcctgctgcagagagagtgtgatgttgaacccaatgacactgtc
aacaccatctacaagagatttctcttcccagagggagtaaaaggcacagtggaagctgtg
aggctgattgcagaggggaaggccccgaagatcacacagccagcggagggagccacgtat
gagtgcatccaaaagaaggacaatgccaagattgactggaaccagtctgctgaggctctc
cacaactggatcagaggaaacgacaaagtgccgggagcctgggccgaggtcgatggacag
aaagtgactttctatggctcctctttggtggataatgggaccgcagttaatggtcaaccc
ctggaaatccctggagccagccaacccggtatcgtcactaaatctggcctggtgctgttt
ggcaatgacggcaagactctgctggtgaagaatctgcagtttgaggatggaaagatgatt
gctgcagcgcagtactttcgctctgggagcagtgctgctgtggagctcactgaggaggag
aaaaccttcgctgtacagatgagggcagtgtggcagagtatcctgagtaatgtgagccag
attgaagactccacagattttttcaaatctggtgctgcttccatggatgtggtcaggctg
gtggaggaggtgaaacttcgagccagcagttgccagctgcagaacgaggatgtctacatg
aatacaacctttcaggatttcatccaaatgtgtgtgaggaagctcagaggggaggacgat
gaagaggagttggtagtcgactatgtggagaagaacataaacaacatgacaataaagatg
cctcatcagttattcatcaacggagagtttgttgatgcagagggaggaaagacctacaaa
accatcaaccccactgacggcacggccatctgcgatgtgtctctggcccagatcagtgat
gtggacagggcagtggctgcagctaaagaggcctttgaagagggagagtggggcaagatg
aacccaagggacagaggaagactcatctacaggctggctgacctgatggaggagcaccag
gaggagctggccactattgaagccattgactctggagctgtgtacactctggccctcaag
acccacgtgggcatgtccatccagactttccgctattttgctggctggtgtgacaagatc
caaggcagcaccatccccatcaaccaggccaggcccaatcgtaacctgacttttaccaag
aaggaaccaatgggagtttgtgccattgtgattccttggaactaccctctaatgatgctg
gcctggaagacagcagcctgcctggcagctggaaacacagtggtcctcaaacctgcacag
gtcaccccactgacagcactgaagtttgctgaactggcagcaagagcgggactgcctaaa
ggagtgattaacattctgcctggatcaggtgccctggtgggtcagcgtctctccgaccat
cccgacgtccggaaacttggcttcacaggttccacagagattggtaaacacatcatgaag
agctgtgcagtcagcaatgtaaagaaagtctctctggagcttggaggaaaatcaccactt
atcatcttcagtgactgcgagatggacaaggccgtgcgcatgggcatgagctcagtgttc
tttaacaagggagagaactgcatcgctgctggcagactgtttgtggaagactccattcat
gacctgtttgtacaaaaagtggttgaggaagtcaaaaagatgaagattggtgatccactg
gaccgctcaacagaccatggacctcagaaccacaaggcccacctggacaaactggtggaa
tattgtcagactggcgtcaaggagggagccaccctggtctgtggtggcagacaggtacaa
cgaccaggtttcttctttgaacccacagtgtttactgatgtgcaggaccacatgtacatt
gctaaagaggagtcttttggccctgttatgatcatctccaagtttaagagcggtgaagtg
gatgacgtcctgaggagggccaatgctacagagtatggcctggcatcaggtgttttcaca
cgggacatcagcaaagcactgtatgtcagtgaaaggctcaatgccggcacagttttcgtc
aacacctacaacaagaccgacgtcgctgcgcccttcggaggcttcaagcagtccggattt
ggtaaagacctgggacaagacgctctcaacgaatacctgaagacaaagacagtgaccatt
gagtattag

DBGET integrated database retrieval system