KEGG   Maylandia zebra (zebra mbuna): 101480724Help
Entry
101480724         CDS       T02814                                 

Definition
kynureninase-like
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    101480724
Enzymes [BR:mze01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     101480724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 468 aa AA seqDB search
MDEFDGSTPSETVKRVSDSLGCSPTSAEVAAYFDKHDKLRHFREEFLVPKITELPPSDLS
LVNGAKDCIYFSGNSLGLQPKNVKKYLEEELDTWAKIAIHGHTMGARPWAWAENNIEELM
AKVVGAKTEEVALMNGLTVNLHLLLLSFYKPTKTRHKILLEDKAFPSDHYAVESQIRLRG
LDPKDSMLLLSPKPGEETLKTEDILEVIEKQGDSIAVVMFSGVQYYTGQLFDMACITEAG
QRKGCYVGFDCAHAAGNVELELHDWGVDFACWCSYKYINSGAGGLAGAFIHEKHKHTIKP
TLMGWWGHDLKSRFQMTNVMELQPGVSGFRLSNQPILLVCPLQASLEVFNMTTMQALRKK
SLLLTGYLEYLIKHYYTKDPAQPHKPHVHIITPSDPQQRGCQLSLSFSVPIKRVFEELEK
RGVACDMREPTVLRVAPVPMYNSFSDVHRFIRALGEALAASKQDWERN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtttgacggctcgactcccagcgaaactgtgaaacgagtgtctgactctctg
ggctgcagtccaacctctgcagaagtggctgcttacttcgataaacatgacaaactgcga
cacttcagggaggaatttctggtgccgaaaattacagagctgccgccttctgatctctca
ctggtcaatggtgccaaggactgcatctacttttcgggcaactcgttggggctgcagcct
aaaaatgtcaagaagtacctggaagaggaactggacacgtgggccaagattgctatccat
ggacacacaatgggtgcgagaccttgggcatgggctgaaaacaacattgaggaactgatg
gccaaagttgtaggagctaaaactgaggaagtggcactgatgaatggtctgacagtaaat
ttacatcttctgctgctttccttctacaaacccactaaaactcgacacaaaatccttcta
gaggacaaggcctttccatctgatcactacgctgtggagtcgcagatccgtctgcgagga
ctcgatcctaaggacagcatgctgttgctgtcacccaagccgggagaagagaccctgaaa
accgaggacatcctggaggtgatcgagaagcagggcgactctatcgcagtggtaatgttt
agcggggttcagtattacaccggccagctgttcgacatggcctgcatcactgaggctggc
cagaggaagggctgttatgtcggcttcgactgcgcccacgcggcaggaaacgtcgagttg
gaactgcacgactggggtgtcgacttcgcctgctggtgctcctacaagtatataaactca
ggtgctggtggtctcgctggggcgtttatccatgagaaacacaaacataccatcaaacca
acgctgatgggatggtggggacatgacctgaagtctcggtttcagatgactaacgtgatg
gagctgcagcctggagtgagcggcttcaggctgtcgaaccaaccaatcctgctggtctgt
ccactgcaggccagtctggaggtgtttaacatgaccaccatgcaggctctgcgcaagaag
tccctcctactgacaggctacctggagtatctgattaagcactactacactaaggacccg
gctcagcctcacaaacctcacgtccacatcatcacaccgtcggaccctcagcagagaggc
tgccagctttcgctctccttctctgttcccatcaaaagagtcttcgaggagctggagaag
aggggcgtcgcttgtgacatgagggagcccaccgtgctgcgagttgctccggtgccaatg
tacaactccttcagtgatgtccatcgcttcatcagagcgctgggagaggctctggccgcc
agcaagcaagattgggagaggaactga

DBGET integrated database retrieval system