KEGG   Maylandia zebra (zebra mbuna): 101480766Help
Entry
101480766         CDS       T02814                                 

Definition
(RefSeq) ecto-ADP-ribosyltransferase 4-like
Organism
mze  Maylandia zebra (zebra mbuna)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 285 aa AA seqDB search
MGCRRKVLLAAIIFMLVCYKVAAKDTRLLDVQKTTDVVDDQYKGCREEAMKKFIESDVLK
KELSNSEGFQKAWNKSNECSKQIPGGRKEHTAALSVYLKGDQPFILALNKAIETMGGNVS
IYKNRFQFKSLHFLLMDSMRLLKPKECKNFYVFRDGKNKPQKGSTVRFTSFTLAYSNYEE
LKRLEDVNENTILHLTSCFFVNLKDYVCGQEQDEILLSPAEVFTVQRVKTKTTSDGDEYL
EIVLNHSGLNSSHNCYMFSRSPPAAVSTLWLVSVLAASSLFSLTA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcagaagaaaagtgcttcttgctgcaataattttcatgcttgtctgctataaa
gtggccgcaaaggatacaagattactggatgtccaaaagaccacagatgttgtagatgac
cagtacaaaggatgtcgtgaagaggccatgaagaagttcatcgagtcagacgtgttaaaa
aaagaactaagcaacagtgaaggatttcagaaagcgtggaataaaagtaacgagtgttca
aagcagatccctggaggaagaaaagagcatactgctgcactttcagtctatcttaaagga
gaccagcctttcatactagcactgaacaaagcaatagagacaatgggtggaaatgttagc
atctataaaaaccgattccaattcaagtctcttcatttcctgctgatggactccatgagg
ctgctgaagccaaaggagtgcaagaacttttatgtttttcgagatggtaaaaacaaacca
cagaaaggctccacagtgagatttacaagtttcactttagcttattcaaactatgaagag
ctaaagagacttgaagatgtcaatgagaatactattttacatctcacttcttgcttcttt
gtcaacctgaaagactatgtgtgcggtcaagaacaggatgaaatactcttatctccagca
gaggttttcactgtgcaacgagtgaaaacaaaaactacatcggatggtgacgaatacctt
gagattgttttaaaccactcaggactgaacagctcacacaactgttacatgttttcacgg
tctcctccagctgctgtctccaccctgtggcttgtatcagtgcttgcggcctcatctttg
ttttctttaactgcttag

DBGET integrated database retrieval system