KEGG   Maylandia zebra (zebra mbuna): 101481776Help
Entry
101481776         CDS       T02814                                 

Definition
thymidine kinase, cytosolic-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mze00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mze00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 233 aa AA seqDB search
MNMDCVDFPRVLPNSPRKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYNCLVIKYAKD
TRYSDTGMATHDKSTMEAVPANCLTDVRPLALRACVIGIDEGQFFPDAVEFCEEMANLGK
TIIVAALDGTFQRKAFGNILNLVPLAESVVKLHAVCMQCFKEAAYTKRIGAEKEVEVIGG
ADKYQAVCRKCYGGLMVDKENSSPFRNETPQNALIGKLVDSGVPRKLFSSLHL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggactgcgtagatttcccaagagtcctaccaaactcaccgaggaaagcccgg
ggacaaattcaggtaatttttggacctatgttttcaggcaaaagcactgaactgatgaga
agagtgcgccgtttccagatagcccagtacaactgcctggtgatcaaatatgccaaagat
acacggtactccgacacgggcatggccactcatgacaaaagcacaatggaagctgtacca
gcaaattgtctgacggatgtgcggcctttggcactacgagcttgtgtgattggaatcgat
gaaggacagtttttcccagatgctgtggagttttgtgaggagatggctaatttggggaag
acaatcattgtagctgccttagatggaaccttccagagaaaggcgtttggaaacatcctg
aaccttgttcctctggcggagagtgtagtgaagctccacgctgtctgcatgcagtgtttc
aaagaagctgcctacaccaagaggataggagctgaaaaggaggtggaagtgattggtgga
gcagacaaatatcaggcggtgtgcagaaagtgttacggaggtctgatggttgacaaagag
aacagttctcccttcaggaacgaaactccacaaaatgccctcataggaaaactcgtggac
agcggtgttcccaggaagctcttctcctctctacacctctga

DBGET integrated database retrieval system