KEGG   Maylandia zebra (zebra mbuna): 101482035Help
Entry
101482035         CDS       T02814                                 

Gene name
kat2a
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101482035 (kat2a)
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101482035 (kat2a)
Transcription machinery [BR:mze03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101482035 (kat2a)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101482035 (kat2a)
   HAT complexes
    PCAF complex
     101482035 (kat2a)
    STAGA complex
     101482035 (kat2a)
    TFTC complex
     101482035 (kat2a)
    SAGA complex
     101482035 (kat2a)
    SLIK complex
     101482035 (kat2a)
    ADA-HAT complex
     101482035 (kat2a)
    HAT-A2 complex
     101482035 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 798 aa AA seqDB search
MSDPAAQALQPRLLQAQSAGSAGSSTTTTAGSGSGNSDPVRPGLSQQQRASQKKAQVRAF
PRAKKLEKLGVFSACKANDTCKCNGWKNPNPPSATRIDLQQQAASLSEPCRSCGHALANH
VSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVV
EGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMFELSKMFLLCLNYWKLETPTQYR
QRTQKDDGTAYKVDYTRWLCYCHVPQSNDSLPRYETTQVFGRNLLKSIFTVTRRQLLEKF
RVEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASDGTQLGHQTVISP
ASVSGSPALSKCLNSSSSVSSMDTGGAEPKTGEKRKLPETLTLEDAKRIRVMGDIPMELV
NEVMMTITDPAAMLGPETNLLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMW
LVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFC
AVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYL
GYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQSQIRKVYPGLTCFKEG
VRQIPVESIPGIRETGWKPSNKDKGKEVKDPDVLYNMLKNLLAQIKTHPDAWPFMEPVKK
SEAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSEYCKCAN
TLEKFFYFKLKDGGLIEK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacccggcggcgcaggccttacaaccccggcttcttcaagcccagtctgctggg
tcagcgggctccagtactactactactgcaggctcaggatcagggaacagtgacccggtc
agaccagggctcagccagcaacaacgtgcaagccagaaaaaagcacaagtccgagctttc
ccacgggcgaagaagcttgaaaaacttggcgtattctccgcatgcaaggctaatgacaca
tgcaagtgcaatggatggaaaaacccaaacccaccgtcggccacacgtattgatctgcaa
cagcaagcagccagcctaagcgagccctgccgcagctgtggacatgctctggctaatcat
gtgtcacatctggagaacgtgtctgaagatgagattaacaggctgttggggatggtggtt
gatgtggagaacctttttatgtctgtacacaaagaagaagacactgacaccaagcaggtc
tatttctacctttttaagctgctgaggaaatgcatccttcagatgagccagccagtcgta
gaaggatccctcggaagtccaccttttgagaagcccaacattgagcagggggttttgaat
tttgtccagtataagttcagccaccttgcaccaaaggaaagacagacaatgtttgaactg
tcaaagatgttccttttgtgcctaaattactggaagcttgagacccctacgcagtatcgt
caacgtacccagaaggatgatgggacagcttacaaagtggactacactaggtggttgtgc
tattgccatgttccgcaaagtaatgacagcttaccgcgctatgaaaccactcaggtgttt
gggcgcaacttgctcaagtccattttcactgtcacccgacgccaactcctggagaagttt
agggtggagaaggataaactgctaccagagaaacgtacacttatccttacacatttcccc
aagttcttgtccatgctggaggaggaaatctatggtgagaattcacccatatgggaggct
gatttcaccatgccggcctccgatggcacacagctcggacatcagacagtgatcagtccg
gcttcagtgtctggctctcctgctctgtccaagtgtctgaacagcagctcttctgtcagc
agcatggatactggtggagcagaaccaaagacaggagaaaagcgcaaacttcccgagacc
ttgaccctggaggatgccaagcggattcgtgtgatgggagatataccaatggagctggtc
aatgaagtcatgatgacaatcactgaccctgctgctatgctcggaccagagactaatctg
ctgacaccaaatgctgcccgtgatgagactgcaaggctggaggagagacgtggtatcata
gagtttcatgtcattggaaactcactttcccagaaatcaaacaagaagatcctgatgtgg
ctggttggcctacagaatgtcttttcacatcagttacctcgtatgcccaaagagtacata
acacgactggtgtttgacccgaaacacaagaccctagcccttatcaaagatggccgcgtc
attggaggcatctgttttaggatgtttcccactcagggcttcacagagatcgtcttttgt
gccgtcacatccaatgagcaagttaagggctatggtacccacctgatgaaccaccttaag
gagtaccacatcaaacacaatatcctctatttcctcacctatgctgatgagtatgccatt
ggctacttcaagaagcagggcttttccaaagacatcaaagtgccgaagagtcgatacctt
ggatacatcaaagactacgagggagcgaccctcatggagtgcgaactgaaccctagaatc
ccttataccgagctttctcatatcattaaaagacagaaggagattattaagaaactgatt
gagaggaaacaaagccagatcagaaaggtttacccgggtctcacctgcttcaaagaggga
gtacgacagatcccagtggagagcattccaggcataagagagacaggctggaaacccagt
aacaaggacaaagggaaagaggtgaaggatcctgatgtgctatacaacatgctgaagaac
cttctcgcccagataaagactcatcctgatgcttggccctttatggaaccagtgaagaaa
tctgaagctccggattactacgaaatcatccgttttcctattgacctaaagactatgaca
gaaagactcaagaacagatactatgtgaccaagaaactttttattgccgacctacagcga
atcatcaccaactgtcgcgagtacaaccccccagacagcgagtactgcaagtgtgccaac
accttagaaaaatttttctacttcaaattaaaagacggaggtctgattgagaaatga

DBGET integrated database retrieval system