KEGG   Maylandia zebra (zebra mbuna): 101482035Help
Entry
101482035         CDS       T02814                                 

Definition
histone acetyltransferase KAT2A-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101482035
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101482035
Transcription machinery [BR:mze03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101482035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 798 aa AA seqDB search
MSDPAAQALQPRLLQAQSAGSAGSSTTTTAGSGSGNSDPVRPGLSQQQRASQKKAQVRAF
PRAKKLEKLGVFSACKANDTCKCNGWKNPNPPSATRIDLQQQAASLSEPCRSCGHALANH
VSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVV
EGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMFELSKMFLLCLNYWKLETPTQYR
QRTQKDDGTAYKVDYTRWLCYCHVPQSNDSLPRYETTQVFGRNLLKSIFTVTRRQLLEKF
RVEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASDGTQLGHQTVISP
ASVSGSPALSKCLNSSSSVSSMDTGGAEPKTGEKRKLPETLTLEDAKRIRVMGDIPMELV
NEVMMTITDPAAMLGPETNLLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMW
LVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFC
AVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYL
GYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQSQIRKVYPGLTCFKEG
VRQIPVESIPGIRETGWKPSNKDKGKEVKDPDVLYNMLKNLLAQIKTHPDAWPFMEPVKK
SEAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSEYCKCAN
TLEKFFYFKLKDGGLIEK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacccggcggcgcaggccttacaaccccggcttcttcaagcccagtctgctggg
tcagcgggctccagtactactactactgcaggctcaggatcagggaacagtgacccggtc
agaccagggctcagccagcaacaacgtgcaagccagaaaaaagcacaagtccgagctttc
ccacgggcgaagaagcttgaaaaacttggcgtattctccgcatgcaaggctaatgacaca
tgcaagtgcaatggatggaaaaacccaaacccaccgtcggccacacgtattgatctgcaa
cagcaagcagccagcctaagcgagccctgccgcagctgtggacatgctctggctaatcat
gtgtcacatctggagaacgtgtctgaagatgagattaacaggctgttggggatggtggtt
gatgtggagaacctttttatgtctgtacacaaagaagaagacactgacaccaagcaggtc
tatttctacctttttaagctgctgaggaaatgcatccttcagatgagccagccagtcgta
gaaggatccctcggaagtccaccttttgagaagcccaacattgagcagggggttttgaat
tttgtccagtataagttcagccaccttgcaccaaaggaaagacagacaatgtttgaactg
tcaaagatgttccttttgtgcctaaattactggaagcttgagacccctacgcagtatcgt
caacgtacccagaaggatgatgggacagcttacaaagtggactacactaggtggttgtgc
tattgccatgttccgcaaagtaatgacagcttaccgcgctatgaaaccactcaggtgttt
gggcgcaacttgctcaagtccattttcactgtcacccgacgccaactcctggagaagttt
agggtggagaaggataaactgctaccagagaaacgtacacttatccttacacatttcccc
aagttcttgtccatgctggaggaggaaatctatggtgagaattcacccatatgggaggct
gatttcaccatgccggcctccgatggcacacagctcggacatcagacagtgatcagtccg
gcttcagtgtctggctctcctgctctgtccaagtgtctgaacagcagctcttctgtcagc
agcatggatactggtggagcagaaccaaagacaggagaaaagcgcaaacttcccgagacc
ttgaccctggaggatgccaagcggattcgtgtgatgggagatataccaatggagctggtc
aatgaagtcatgatgacaatcactgaccctgctgctatgctcggaccagagactaatctg
ctgacaccaaatgctgcccgtgatgagactgcaaggctggaggagagacgtggtatcata
gagtttcatgtcattggaaactcactttcccagaaatcaaacaagaagatcctgatgtgg
ctggttggcctacagaatgtcttttcacatcagttacctcgtatgcccaaagagtacata
acacgactggtgtttgacccgaaacacaagaccctagcccttatcaaagatggccgcgtc
attggaggcatctgttttaggatgtttcccactcagggcttcacagagatcgtcttttgt
gccgtcacatccaatgagcaagttaagggctatggtacccacctgatgaaccaccttaag
gagtaccacatcaaacacaatatcctctatttcctcacctatgctgatgagtatgccatt
ggctacttcaagaagcagggcttttccaaagacatcaaagtgccgaagagtcgatacctt
ggatacatcaaagactacgagggagcgaccctcatggagtgcgaactgaaccctagaatc
ccttataccgagctttctcatatcattaaaagacagaaggagattattaagaaactgatt
gagaggaaacaaagccagatcagaaaggtttacccgggtctcacctgcttcaaagaggga
gtacgacagatcccagtggagagcattccaggcataagagagacaggctggaaacccagt
aacaaggacaaagggaaagaggtgaaggatcctgatgtgctatacaacatgctgaagaac
cttctcgcccagataaagactcatcctgatgcttggccctttatggaaccagtgaagaaa
tctgaagctccggattactacgaaatcatccgttttcctattgacctaaagactatgaca
gaaagactcaagaacagatactatgtgaccaagaaactttttattgccgacctacagcga
atcatcaccaactgtcgcgagtacaaccccccagacagcgagtactgcaagtgtgccaac
accttagaaaaatttttctacttcaaattaaaagacggaggtctgattgagaaatga

DBGET integrated database retrieval system