KEGG   Maylandia zebra (zebra mbuna): 101482738Help
Entry
101482738         CDS       T02814                                 

Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00512  Mucin type O-glycan biosynthesis
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101482738
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     101482738
Glycosyltransferases [BR:mze01003]
 Glycan extension
  Type 3 chain
   101482738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 101482738
NCBI-ProteinID: XP_004558811
Position
LG20
AA seq 403 aa AA seqDB search
MKGFSSRLGFSLGFILGACSTYFFLHQVWFERSYPVLSGAQEKVTAVRERPTSWRKEGAA
VKNLHLPHRTDEDSQVADMLYQKVRVLCWVMTGPYNLQSRAQHVRATWSRHCNIVVFMSS
VDDPDFPTVGLGTKEGRDQLYWKTIRAFHYVYEHHGNEADWFLKADDDTYVVVDNLRWIL
SNHSSEEPIYFGKRFKPYTKQGYMSGGAGYVLSKEALKRFVEGFRTKVCTHTTPVEDLAL
GQCLEKMGVLAGDSRDTLQRETFHPFVPEHHLTGKFSKSFWYWSYCYYPIVEGPQCCSDL
AVSFHYIEAELMYVMEYYTYHLRAYGYIPRYQPSLRHGLNVSPHSQTAVTAGLKAVRGVK
DGKNRTTVAFSLNGNQTKEDTVTEEKETENLNSHLTVNRTAVE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcttcagctccagattgggcttttcgctgggcttcattttaggggcctgcagt
acgtacttcttccttcaccaggtgtggtttgagagaagttaccctgttctgtcaggagct
caggaaaaagtcactgctgtaagggagaggccgaccagctggaggaaggagggagctgct
gttaagaatctgcaccttcctcaccgtacagatgaagacagccaggtggcagatatgttg
tatcagaaagtacgtgttctctgttgggtgatgacggggccgtataacctgcagagcagg
gcccaacatgtcagggctacctggagtcggcactgcaacatcgtcgtgttcatgagctct
gtggacgaccctgacttccccactgtgggcctggggacaaaggagggccgtgaccagctc
tactggaagaccattcgagcgttccattatgtctacgaacaccacgggaatgaagcagac
tggttcttaaaagcggatgatgacacctatgtggtagtggacaacctgcgctggattctg
tccaaccactcctccgaagaaccaatctattttggcaagcgcttcaaaccttataccaaa
caaggctacatgagtgggggagcaggttatgtactcagtaaagaagccctcaaaagattt
gtggaaggctttcgaaccaaagtttgcacacacacgacccctgtggaagacctagctctc
ggtcagtgtttggagaagatgggtgttctggcaggagattccagagacactttgcaacga
gaaacttttcacccatttgtgccagagcaccatcttactggcaagttctccaagagcttc
tggtactggagctattgctactacccaattgttgagggtccgcagtgctgctcagacctg
gctgtatcgtttcattatatcgaagcagagctgatgtacgtgatggagtactacacctac
cacctaagagcgtatggttatattccacgctaccagccctctttacgtcatggtttgaat
gtcagcccacactcgcagacggctgtaacagcgggacttaaagcagttcgaggggtgaag
gacggaaagaatcgcacaactgttgccttttctctcaatggaaaccaaaccaaagaggat
acggtgacagaggaaaaggagacggagaatttaaactcccatctcactgtgaacaggact
gcagtcgaataa

DBGET integrated database retrieval system