KEGG   Maylandia zebra (zebra mbuna): 101482738Help
Entry
101482738         CDS       T02814                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:mze00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 403 aa AA seqDB search
MKGFSSRLGFSLGFILGACSTYFFLHQVWFERSYPVLSGAQEKVTAVRERPTSWRKEGAA
VKNLHLPHRTDEDSQVADMLYQKVRVLCWVMTGPYNLQSRAQHVRATWSRHCNIVVFMSS
VDDPDFPTVGLGTKEGRDQLYWKTIRAFHYVYEHHGNEADWFLKADDDTYVVVDNLRWIL
SNHSSEEPIYFGKRFKPYTKQGYMSGGAGYVLSKEALKRFVEGFRTKVCTHTTPVEDLAL
GQCLEKMGVLAGDSRDTLQRETFHPFVPEHHLTGKFSKSFWYWSYCYYPIVEGPQCCSDL
AVSFHYIEAELMYVMEYYTYHLRAYGYIPRYQPSLRHGLNVSPHSQTAVTAGLKAVRGVK
DGKNRTTVAFSLNGNQTKEDTVTEEKETENLNSHLTVNRTAVE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcttcagctccagattgggcttttcgctgggcttcattttaggggcctgcagt
acgtacttcttccttcaccaggtgtggtttgagagaagttaccctgttctgtcaggagct
caggaaaaagtcactgctgtaagggagaggccgaccagctggaggaaggagggagctgct
gttaagaatctgcaccttcctcaccgtacagatgaagacagccaggtggcagatatgttg
tatcagaaagtacgtgttctctgttgggtgatgacggggccgtataacctgcagagcagg
gcccaacatgtcagggctacctggagtcggcactgcaacatcgtcgtgttcatgagctct
gtggacgaccctgacttccccactgtgggcctggggacaaaggagggccgtgaccagctc
tactggaagaccattcgagcgttccattatgtctacgaacaccacgggaatgaagcagac
tggttcttaaaagcggatgatgacacctatgtggtagtggacaacctgcgctggattctg
tccaaccactcctccgaagaaccaatctattttggcaagcgcttcaaaccttataccaaa
caaggctacatgagtgggggagcaggttatgtactcagtaaagaagccctcaaaagattt
gtggaaggctttcgaaccaaagtttgcacacacacgacccctgtggaagacctagctctc
ggtcagtgtttggagaagatgggtgttctggcaggagattccagagacactttgcaacga
gaaacttttcacccatttgtgccagagcaccatcttactggcaagttctccaagagcttc
tggtactggagctattgctactacccaattgttgagggtccgcagtgctgctcagacctg
gctgtatcgtttcattatatcgaagcagagctgatgtacgtgatggagtactacacctac
cacctaagagcgtatggttatattccacgctaccagccctctttacgtcatggtttgaat
gtcagcccacactcgcagacggctgtaacagcgggacttaaagcagttcgaggggtgaag
gacggaaagaatcgcacaactgttgccttttctctcaatggaaaccaaaccaaagaggat
acggtgacagaggaaaaggagacggagaatttaaactcccatctcactgtgaacaggact
gcagtcgaataa

DBGET integrated database retrieval system