KEGG   Maylandia zebra (zebra mbuna): 101483316Help
Entry
101483316         CDS       T02814                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101483316
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101483316
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101483316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 540 aa AA seqDB search
MASTRRSFLALFLLVVLGSSIATVEEENSEFWRSQARKTLQAALDRKLNTNVAKNILFFL
GDGMGLTTLTAARILKGQLENQPGEETVMTMDTFPNVGLAKTYSVDFQVADSAATATAYL
CGVKTNLNIVGVNAAGRNGVCRTQKGNEVTSILKWAKDAGKSVGIVTTTRVQHATPAGSY
AHSASRTWYSDADMPDSAKTDGCTDISFQLINNTDIDVIIGGGRKYMTPTGTKDPEYPTD
YFSNGERKDGRDLIKEWQNLKTGKVAHYVWNKADFDAVDPETTDYLMALFEPGDLRYEEE
RDPSTDPSIIETTEKAIRILQKNPKGFFLLVEGGRIDQAHHAGRASMALHEAVAFDRAIA
KGLELTEEHETLTVVMADHSQPLTFNGFPFRGNSILGKSPLWASDMLPYTTLMYGNGPGH
KIVNGARPDIRNVDTKSKDYIQQAAVPVDTTTHSGEDVAVLARGPMAHLFQGVNEQNYIA
HAMGYAACVGADLRHCEGQTTPPLVHITLEYNKNGARAVSASAALLGNFLSVLLAITVLM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacaagaaggtcgttcctggctctctttctgttggtggtgcttggatcatcc
attgccacagttgaggaagagaactcagagttctggaggtcacaggcgaggaagacactg
caggcagcactagacaggaagctgaacaccaacgttgccaagaacatcctgtttttcctt
ggagatggtatgggactcacaaccctcacagcagctcgtattctcaagggacagctggag
aaccagccaggggaggagacagtgatgactatggacaccttccccaatgtggggctggcc
aagacctacagtgtggacttccaggttgcagacagcgcagccacagccacagcctatctg
tgtggggtgaaaaccaacctgaacatcgttggagtgaatgcggcgggtcgcaacggagta
tgcagaactcagaagggcaacgaggtgacgtccatcttgaagtgggccaaagatgctggc
aagtctgtgggcatcgtaacaaccacgagggtgcaacacgccaccccagcaggcagctac
gcccacagtgccagcaggacgtggtacagtgatgccgatatgcctgattctgctaagacg
gacggctgcacggatatctcattccagctcatcaacaacacagacattgatgtgatcatt
ggcggcggtagaaagtacatgacccctactggtaccaaggaccctgaataccccacagac
tacttttcaaacggtgaaagaaaggatgggcgtgacctgatcaaagagtggcagaactta
aaaactgggaaggttgcccactatgtgtggaataaagcagattttgacgctgtggaccct
gaaaccactgactacctcatggctctgttcgaacctggtgatctccgctacgaggaggag
agggacccgagcacggatccgtccatcatcgagaccacagaaaaggccatccgcatccta
cagaaaaaccctaaaggcttcttcctgttagtggagggtgggcgtattgaccaggctcac
catgctgggcgggcctccatggccctgcatgaggcggttgcttttgaccgtgctatcgct
aagggcctcgaactcaccgaagagcatgaaactctcactgtagtgatggctgaccactct
cagcctcttaccttcaatggcttcccctttcgtgggaacagcattctgggtaaatctcca
ctgtgggcaagtgacatgttgccttataccacgctcatgtacggcaatggacctgggcac
aaaatcgttaatggcgcacgccctgacatccgcaatgttgacaccaaatctaaagactac
atccagcaggcagctgtccccgtagatacaacaacccacagtggagaggatgtggcagtg
ctggcccgtggacccatggcccacctcttccagggtgtcaacgagcagaactatattgcc
catgccatgggctacgctgcctgcgtgggtgctgacctaaggcactgtgaggggcaaact
acaccacctttggttcacataacccttgaatataacaagaacggggccagagcagttagt
gcctcagcagctttgctcggtaacttcctgagcgtgctgttggccatcacagtcctcatg
taa

DBGET integrated database retrieval system